Recombinant Rat Zinc transporter ZIP4 (Slc39a4)

Shipped with Ice Packs
In Stock

Description

Definition and Overview of Recombinant Rat ZIP4 (Slc39a4)

Recombinant Rat ZIP4 (Slc39a4) is a synthetic version of the zinc transporter protein ZIP4, engineered for experimental or therapeutic applications. This protein belongs to the solute carrier family 39 (SLC39), specifically the ZIP subfamily, which mediates zinc uptake into cells. ZIP4 is critical for intestinal zinc absorption, and its dysfunction is linked to acrodermatitis enteropathica (AE), a severe zinc deficiency disorder . Recombinant ZIP4 is typically expressed in heterologous systems (e.g., HEK293 cells, E. coli) and retains structural and functional properties of the native protein, enabling studies on zinc homeostasis, disease mechanisms, and therapeutic interventions .

Functional Mechanisms

ZIP4 operates as a uniporter for Zn²⁺, facilitating uptake into cells. Its activity is tightly regulated by zinc availability:

  1. Zinc deficiency: ZIP4 mRNA stabilizes, protein traffics to the apical membrane, and N-terminal cleavage enhances surface expression .

  2. Zinc repletion: ZIP4 is internalized, ubiquitinated, and degraded .

ZIP4 also transports trace amounts of Cu²⁺, Cd²⁺, and Ni²⁺ at higher concentrations, though its primary role is zinc-specific .

Post-Transcriptional Regulation

ZIP4 expression is dynamically controlled by zinc levels:

MechanismEffect on ZIP4Source
mRNA stabilityStabilized during zinc deficiency
Protein traffickingApical membrane localization (zinc-deficient); internalization (zinc-replete)
Proteolytic cleavageTruncated N-terminus enhances surface expression

Interaction with Other Pathways

ZIP4 influences broader cellular processes:

  • mTORC1 signaling: Modulates catabolic/anabolic balance in enterocytes .

  • Wnt/β-catenin pathway: Zinc depletion via ZIP4 knockout disrupts Paneth cell function and intestinal stem cell niches .

Disease Modeling and Therapeutic Potential

ApplicationDescriptionSource
Acrodermatitis enteropathica (AE)Recombinant ZIP4 used to study pathogenic mutations (e.g., G526R, Leu372Val)
Cancer researchZIP4 overexpression linked to tumor growth; knockdown reduces cell proliferation
Zinc deficiency studiesMouse models (e.g., Zip4-intestine knockout) demonstrate systemic zinc depletion, liver iron/manganese accumulation

Genetic Variants and Population Diversity

A Leu372Val polymorphism (rs1871534) in SLC39A4 exhibits extreme population differentiation:

SNPPopulation FrequencyFunctional ImpactSource
Leu372ValCommon in sub-Saharan AfricaReduces zinc transport efficiency; associated with zinc deficiency sensitivity
Leu372Pro/ArgRare pathogenic mutationsPrevents surface trafficking; causes severe AE

Challenges and Future Directions

  • Species-specific insights: Rat ZIP4 studies lag behind human/mouse models; recombinant proteins often rely on conserved functional domains .

  • Therapeutic targeting: ZIP4 modulation could address zinc-deficiency disorders or cancer, but requires better understanding of regulatory mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will accommodate your needs as much as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Slc39a4; Zip4; Zinc transporter ZIP4; Solute carrier family 39 member 4; Zrt- and Irt-like protein 4; ZIP-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-656
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Slc39a4
Target Protein Sequence
VQPYHLLSLLTSGQGALDRTALDGLLNTLVARVHCTDGPCEKCLSVETALALGKPDKPQL APESVLESRYITYLSAAAALYLNDPEKTCKDIRAGLLASHVDDYLAKLESPEAMTLGLSQ LLQKIEAHDASQPTREETCVDVPQLLEEAEEAGVSRSPGLVLTALLDHVLNGSCFQGLPS PQYFVDFVFRQLSSKPRNITLPELEDLMHHLGVGGEDHSDHGDHVDHSHLDREANHQDSE LHATHNSSSSVWDTLCLSAKDVMAVYGLSEEAGVSPQAWAQLTPALVQQQLSEACSSSPI IHVQDQLSQAERYLYGSLATLLICLCAVFGLLLLTCAKCSTATHYIMQTFLSLAVGALTG DALLHLIPKVLGLHTHSGEVHSHEEESIGGQSTWRLLAVLGGFYIFFLFESFFNLLLPRD QDHEKDGPCSHGGHSHGISLQLSPSNLRQSKQPHESSRSDLVTEETPELLNPDTRRLRAE LRMLPYLITLGDAVHNFADGLAVGAAFSSTWKTGLATSLAVFCHELPHELGDFAALLHAG LTVKRALLLNLASALTAFAGLYVALAVGVGEEGETWILAVATGLFLYVALCDMLPAMMNV RDQRPWLLFLLHNVGLLGGWTILLLLSLYEDSITF
Uniprot No.

Target Background

Function
Plays a crucial role in cellular zinc homeostasis as a zinc transporter. Its expression is regulated in response to zinc availability.
Gene References Into Functions
  1. The rapid upregulation of Zip4 expression in the small intestine during zinc deficiency highlights its significant role in the systemic regulation of zinc homeostasis. PMID: 26702153
  2. Chronic alcohol exposure decreases Kruppel-like factor (KLF)4 and ZIP4 expression, subsequently reducing zinc transport into cells and impairing their functionality. PMID: 23013362
  3. The localization of zip1 and zip4 was examined in the brains of adult rats. PMID: 19530166
Database Links
Protein Families
ZIP transporter (TC 2.A.5) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Recycling endosome membrane; Multi-pass membrane protein.

Q&A

What is ZIP4 and what is its primary function in mammals?

ZIP4 (Zinc transporter SLC39A4) belongs to the zinc/iron-regulated transporter-like protein (ZIP) family and functions as a selective transporter that mediates the uptake of Zn(2+) into cells . It plays an essential role in dietary zinc uptake from the small intestine and is responsible for maintaining zinc homeostasis in mammals . The transporter is predominantly expressed on the apical membrane of enterocytes where it facilitates the absorption of dietary zinc .

Functionally, ZIP4 is a transmembrane protein that transports zinc ions from the extracellular space or lumen of organelles into the cytoplasm. Loss-of-function mutations in the SLC39A4 gene cause acrodermatitis enteropathica, a congenital disease characterized by extreme zinc deficiency if left untreated without supplemental zinc . This underscores the critical nature of this transporter in maintaining proper zinc levels in the body.

How is ZIP4 expression distributed across different rat tissues?

ZIP4 expression shows distinctive tissue distribution patterns in rats, with notable expression in specific neural and peripheral tissues:

Tissue TypeZIP4 Expression LevelNotes
Choroid plexusHighImportant for zinc transport at blood-CSF barrier
Brain capillariesModerate to highDetected in capillary endothelial cells
Ependymal cellsNegativeNot detected in cells lining ventricles
Small intestineHighPrimary site for dietary zinc absorption
LiverLow (normal); High (HCC)Dramatically elevated in hepatocellular carcinoma

Unlike ZIP1, which is highly enriched in brain regions with high densities of neuronal cell bodies (hippocampus, thalamus, perifontal cortex), ZIP4 shows a more restricted distribution in the rat brain, being primarily localized to the choroid plexus and brain capillaries . This specialized distribution suggests ZIP4 may play a role in regulating zinc transport across the blood-brain and blood-CSF barriers rather than directly in neuronal function.

How is ZIP4 expression and activity regulated?

ZIP4 expression and function are regulated through multiple mechanisms:

  • Transcriptional regulation: ZIP4 mRNA levels are responsive to zinc availability, with increased expression during zinc deficiency and decreased expression during zinc abundance .

  • Post-transcriptional regulation: The stability of ZIP4 mRNA is regulated in response to zinc availability .

  • Post-translational regulation:

    • Protein localization: ZIP4 undergoes endocytosis and degradation under high zinc conditions

    • Protein processing: ZIP4 protein is processed differently depending on zinc availability

    • Surface expression: ZIP4 surface expression increases during zinc deficiency

In rat models, ZIP4 promoter activity can be monitored using ZIP4 promoter-driven green fluorescent protein expression, as demonstrated in ZIP4 knockout heterozygotes . This approach has revealed that ZIP4 levels can adapt to changes in zinc status, particularly in tissues like brain capillaries, suggesting the brain has mechanisms to adapt to changes in systemic zinc status .

What is the molecular structure of ZIP4 and how does it facilitate zinc transport?

ZIP4 is a multi-pass transmembrane protein with several key structural features:

Structural FeatureDescriptionFunction
Transmembrane domainsMultiple membrane-spanning segmentsForm transport channel across plasma membrane
Extracellular domainN-terminal domain with metal binding motifsMetal ion recognition and binding
Intracellular domainsCytoplasmic regionsRegulatory functions and interactions with cellular machinery
Metal binding sitesSpecific residues coordinating zincFacilitate selective transport of zinc ions

The transporter functions as a uniporter with zinc uptake activity regulated by zinc availability . ZIP4 exhibits polyspecific binding capability, with evidence showing it can also transport Cu(2+), Cd(2+), and possibly Ni(2+), though at higher concentrations than required for zinc . The transporter primarily functions at the plasma membrane, where it mediates the influx of zinc from the extracellular environment into the cytoplasm.

How does ZIP4 contribute to zinc homeostasis in the central nervous system?

ZIP4 appears to play a specialized role in CNS zinc homeostasis that differs from other zinc transporters:

Unlike ZIP1, which is widely expressed throughout neural tissues, ZIP4 expression in the rat brain is primarily restricted to the choroid plexus and brain capillaries . This distinct localization pattern suggests ZIP4 is strategically positioned to regulate zinc movement between blood and cerebrospinal fluid, potentially serving as a gatekeeper for zinc entry into the CNS.

ZIP4 was not detected in ependymal cells lining the ventricles or in other neural elements, further highlighting its specialized function . The presence of ZIP4 in brain capillaries may be particularly significant, as it suggests a role in regulating zinc transport across the blood-brain barrier.

Interestingly, in ZIP4 knockout heterozygotes that express green fluorescent protein regulated by the ZIP4 promoter, GFP was detected in brain capillaries . Since ZIP4 levels are regulated by dietary zinc, this suggests the brain has mechanisms to adapt to changes in systemic zinc status, with possible implications for neurological function and disease.

What molecular mechanisms underlie ZIP4's role in cancer progression?

ZIP4 has been implicated in promoting cancer progression through several molecular mechanisms:

  • Anti-apoptotic effects: RNAi knockdown of ZIP4 in mouse Hepa cells significantly increased apoptosis, suggesting ZIP4 normally functions to suppress apoptotic pathways .

  • Cell cycle regulation: ZIP4 knockdown modestly slowed progression from G0/G1 to S phase when cells were released from hydroxyurea block into zinc-deficient medium, suggesting ZIP4 facilitates cell cycle progression .

  • Enhanced cell migration: Both forced expression of ZIP4 and its knockdown demonstrated that ZIP4 enhances in vitro cell migration in multiple cell types including Hepa cells and MCF-7 cells .

  • EMT promotion: In nasopharyngeal carcinoma, ZIP4 overexpression promoted the epithelial-to-mesenchymal transition (EMT), a crucial process in cancer invasiveness and metastasis .

  • Signal transduction: ZIP4 has been shown to activate several signaling pathways that promote cancer growth:

    • PI3K/Akt pathway: Downregulation of ZIP4 in C666-1 cells resulted in decreased phosphorylation of PI3K p85 (Tyr607), Akt (Ser473), Akt (Thr308), and GSK3β (Ser9)

    • IL-6/Stat3 pathway: In pancreatic cancer, ZIP4 activates this pathway via CREB, leading to increased expression of neuropilin-1, vascular endothelial growth factor, and matrix metalloproteases

These findings are consistent across multiple cancer types, with studies demonstrating that ZIP4 expression is abnormally elevated in hepatocellular carcinoma (HCC), nasopharyngeal carcinoma, pancreatic cancer, and potentially many other cancer types according to meta-analysis of microarray data .

How do genetic variations in ZIP4 affect zinc transport function?

Genetic variations in ZIP4 can significantly impact zinc transport activity, as demonstrated by multiple studies:

The non-synonymous SNP c.1114C>G (rs1871534) in the human ZIP4 gene results in a leucine-to-valine substitution at amino acid 372 (Leu372Val) . Functional characterization revealed that the Val372 variant displays:

  • Significantly reduced surface protein expression

  • Reduced basal levels of intracellular zinc

  • Reduced zinc uptake capacity compared to the Leu372 variant

This polymorphism shows extreme population differentiation between West Africans and Eurasians, being one of the most markedly differentiated genetic variants in the human genome . The functional differences between these variants may have adaptive significance, with some researchers speculating that reduced zinc uptake by the Val372 isoform could potentially confer protection against certain pathogens by restricting zinc availability .

More severe mutations in ZIP4 cause acrodermatitis enteropathica, resulting in nearly absent zinc uptake due to failure of ZIP4 to reach the cell surface . This highlights the critical importance of proper protein trafficking and membrane localization for ZIP4 function.

How does ZIP4 influence radioresistance in cancer cells?

ZIP4 has been shown to modulate the cellular response to radiation in cancer models:

In nasopharyngeal carcinoma (NPC), ZIP4 silencing significantly enhanced radiation-induced apoptosis and growth inhibition of human C666-1 cells in vitro . Furthermore, ZIP4 silencing enhanced the antitumor activity of ionizing radiation (IR), leading to tumor growth inhibition in vivo .

The mechanism appears to involve the PI3K/Akt signaling pathway, which is known to mediate radioresistance in various cancers. Downregulation of ZIP4 in C666-1 cells resulted in decreased phosphorylation of PI3K p85 (Tyr607), Akt (Ser473), Akt (Thr308), and GSK3β (Ser9) , suggesting that ZIP4 normally activates this pro-survival pathway.

This finding has important implications for cancer therapy, suggesting that targeting ZIP4 in combination with radiotherapy may be an effective new treatment approach for cancers that express high levels of ZIP4, such as NPC .

What are the most effective methods for studying ZIP4 protein localization?

Several complementary approaches can be used to investigate ZIP4 protein localization:

MethodApplicationAdvantagesLimitations
ImmunohistochemistryTissue sectionsPreserves tissue architecture; can distinguish cell typesLimited quantification
ImmunofluorescenceCellular localizationHigh resolution; allows co-localization studiesPotential background issues
GFP-tagged constructsLive cell imagingReal-time trafficking; avoid fixation artifactsMay affect protein function
Cell surface biotinylationQuantify surface expressionSpecific for plasma membrane proteinsComplex protocol
Subcellular fractionationBiochemical localizationQuantitative; identifies organelle associationDisrupts cellular architecture

For rodent models, researchers have successfully employed ZIP4 promoter-driven green fluorescent protein expression to monitor ZIP4 expression patterns in tissues like brain capillaries . For protein detection, antibodies against ZIP4 have been used effectively for immunohistochemical detection in paraffin sections of tissues such as liver from FXR-knockout mice .

When examining subcellular localization and trafficking, it's important to consider that ZIP4 localization is dynamic and responsive to zinc availability. Under zinc-deficient conditions, ZIP4 accumulates at the cell surface, while zinc repletion triggers rapid endocytosis and degradation .

What experimental approaches are optimal for assessing ZIP4 zinc transport activity?

Multiple complementary methods are available to measure ZIP4-mediated zinc transport:

  • Radioactive 65Zn uptake assays: This approach directly measures zinc transport kinetics and can determine parameters such as Km and Vmax for zinc uptake.

  • Fluorescent zinc indicators: Probes like FluoZin-3 can be used to measure intracellular zinc levels in real-time, allowing dynamic assessment of zinc influx.

  • Zinc-sensitive reporter systems: Constructs containing zinc-responsive elements coupled to reporters like luciferase can indirectly measure changes in intracellular zinc.

  • ICP-MS or ICP-OES: These techniques provide highly sensitive quantification of total cellular zinc content.

  • Zinc depletion-repletion protocols: Studies have effectively used experimental designs where cells are first cultured in zinc-deficient conditions to upregulate ZIP4 expression, followed by measurement of zinc uptake upon zinc addition .

When assessing the functional impact of genetic variations like the Leu372Val polymorphism, researchers have successfully employed these methods to demonstrate significant differences in zinc uptake capacity between variants .

How can researchers effectively modulate ZIP4 expression in experimental models?

Several approaches have been validated for modulating ZIP4 expression in cell and animal models:

  • RNAi knockdown:

    • Lentivirus vectors expressing shRNA against ZIP4 have been successfully used to silence ZIP4 expression in cell lines like mouse Hepa cells

    • Knockdown efficiency can be assessed by Western blot analysis of membrane proteins, with effective reduction of ZIP4 protein levels observed even under zinc-deficient conditions

  • CRISPR/Cas9 gene editing:

    • Can be used to generate complete knockout or introduce specific mutations

    • Particularly useful for studying the effects of genetic variants like Leu372Val

  • Overexpression systems:

    • Forced expression of either human or mouse ZIP4 has been successfully employed in Hepa cells and MCF-7 cells

    • When designing expression constructs, consider incorporating epitope tags that don't interfere with function for easy detection

  • Conditional knockout models:

    • Tissue-specific ZIP4 knockout approaches have been used successfully, such as the ZIP4 intestine-specific knockout mouse that exhibits systemic zinc deficiency

  • Zinc manipulation:

    • ZIP4 expression and localization can be modulated by altering zinc availability in the culture medium

    • Mouse Hepa cells have been shown to regulate both ZIP4 mRNA stability and protein endocytosis/processing in response to zinc levels

When using these approaches, it's important to verify modulation at both the mRNA and protein levels, as ZIP4 is regulated at multiple levels including transcription, mRNA stability, and protein trafficking.

How does ZIP4 dysregulation contribute to cancer progression?

ZIP4 dysregulation appears to be a common feature across multiple cancer types, with consistent patterns of effects:

Cancer TypeZIP4 Expression PatternFunctional ConsequencesReference
Hepatocellular carcinomaDramatically elevated in tumor vs. non-cancerous tissueReduced apoptosis; Enhanced cell migration
Nasopharyngeal carcinomaHigh expression correlates with higher TN classificationPromotes EMT; Enhanced migration and invasion; Radioresistance
Pancreatic cancerElevated expressionIncreased tumor volume and metastasis; Activation of IL-6/Stat3 pathway
Multiple other cancersAmong top 10% of expressed genes in many cancer typesOften associated with aggressive stage

Meta-analysis of microarray data from the Geo and Oncomine databases suggests ZIP4 mRNA may be elevated in many types of cancer, including lymphoma, melanoma, and metastatic colon cancer . This indicates ZIP4 may serve a fundamental role in cancer biology across diverse tissues.

Mechanistically, ZIP4 appears to influence cancer progression through multiple pathways:

  • Reducing apoptosis and enhancing cell survival

  • Promoting cell cycle progression

  • Enhancing cell migration and invasion

  • Facilitating epithelial-to-mesenchymal transition

  • Activating oncogenic signaling pathways including PI3K/Akt and IL-6/Stat3

These findings suggest ZIP4 could be a promising therapeutic target in cancer treatment strategies.

How can ZIP4 research inform our understanding of zinc deficiency disorders?

ZIP4 research provides crucial insights into zinc deficiency disorders:

Acrodermatitis enteropathica (AE) is directly caused by loss-of-function mutations in the ZIP4 gene, resulting in severe systemic zinc deficiency characterized by dermatitis, alopecia, diarrhea, and growth failure . The disorder demonstrates the essential role of ZIP4 in intestinal zinc absorption and whole-body zinc homeostasis.

Research into ZIP4 function has revealed that both acrodermatitis mutations cause absence of the ZIP4 transporter at the cell surface and nearly absent zinc uptake . This underscores the importance of proper protein trafficking for ZIP4 function.

Beyond AE, ZIP4 research has broader implications for understanding conditions involving zinc dysregulation. For example, a intestine-specific ZIP4 knockout mouse model demonstrated that loss of intestinal ZIP4 expression caused systemic zinc deficiency, leading to disruption of the intestine stem cell niche and loss of intestine integrity .

The discovery of naturally occurring genetic variants like the Leu372Val polymorphism, which shows reduced zinc transport capacity, suggests there may be population differences in zinc homeostasis with potential implications for disease risk and nutritional requirements .

What potential exists for ZIP4 as a therapeutic target?

ZIP4 shows considerable promise as a therapeutic target in multiple disease contexts:

Therapeutic approaches might include small molecule inhibitors of ZIP4 transport activity, antibodies targeting the extracellular domain, or siRNA-based approaches to downregulate expression. Any therapeutic strategy would need to carefully consider potential off-target effects, particularly on intestinal zinc absorption.

What are the major technical challenges in ZIP4 research?

Researchers studying ZIP4 face several significant technical challenges:

  • Protein expression and purification: As a multi-pass membrane protein, recombinant expression and purification of ZIP4 in functional form is technically challenging. Appropriate expression systems, detergents, and stabilization strategies are critical considerations.

  • Antibody specificity: Ensuring antibody specificity for ZIP4 detection is essential, particularly given the existence of multiple ZIP family members with structural similarities. Validation using ZIP4 knockout models is recommended.

  • Dynamic regulation: ZIP4 expression, localization, and activity are highly dynamic and responsive to zinc status. Experimental designs must account for this regulation to avoid misleading results.

  • Functional redundancy: There are 14 ZIP family members in mammals, potentially providing functional redundancy that can complicate phenotypic analysis of ZIP4 manipulation.

  • Tissue-specific effects: ZIP4 function may vary across different tissues and cell types, necessitating careful selection of appropriate model systems for specific research questions.

What are promising future directions for ZIP4 research?

Several emerging areas represent exciting opportunities for advancing ZIP4 research:

  • Structure-function studies: Determination of ZIP4's three-dimensional structure would provide critical insights into its transport mechanism and could facilitate rational drug design efforts.

  • Systems biology approaches: Integrating ZIP4 function into broader zinc homeostasis networks and signaling pathways would enhance our understanding of its role in health and disease.

  • Genetic variation: Further characterization of naturally occurring ZIP4 variants like Leu372Val could reveal insights into zinc homeostasis adaptation across human populations and potential implications for disease risk.

  • Therapeutic targeting: Development of specific inhibitors or modulators of ZIP4 activity could have applications in cancer therapy and other conditions involving ZIP4 dysregulation.

  • Metal specificity and regulation: While primarily a zinc transporter, ZIP4 can also transport other metals like copper and cadmium . Better understanding of its metal selectivity and regulatory mechanisms could provide insights into metal homeostasis disorders.

  • Single-cell analysis: Investigating ZIP4 expression and function at the single-cell level could reveal previously unappreciated heterogeneity in zinc transport capacity within tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.