Recombinant Rat Zinc transporter ZIP9 (Slc39a9)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Zinc Transporter ZIP9 (Slc39a9)

ZIP9 belongs to the SLC39A family of zinc transporters, which facilitate zinc influx into the cytosol from extracellular compartments or organelles . The rat ortholog (Slc39a9) shares 84–90% sequence identity with human ZIP9, suggesting conserved roles in zinc homeostasis and signaling . Recombinant forms of this protein are typically generated for functional studies, antibody validation, and mechanistic investigations .

Zinc Transport and Homeostasis

  • ZIP9 mediates zinc release from the Golgi into the cytosol, inhibiting protein tyrosine phosphatases (PTPases) and enhancing phosphorylation of Akt and Erk kinases .

  • In ZIP9-knockout cells, PTPase activity increases, disrupting B-cell receptor (BCR) signaling .

Non-Classical Androgen Signaling

  • ZIP9 doubles as a membrane androgen receptor (mAR), binding testosterone and activating G-protein-coupled pathways .

  • In cancer cells, ZIP9 mediates testosterone-induced apoptosis via MAPK- and zinc-dependent pathways .

Research Findings in Model Systems

SystemKey FindingsReference
Human Prostate/ Breast Cancer CellsZIP9 activation by testosterone induces apoptosis via Erk/CREB phosphorylation .
Chicken DT40 B CellsZIP9 regulates cytosolic zinc, enhancing Akt/Erk phosphorylation and inhibiting PTPases .
Spermatogenic CellsMediates testosterone-induced tight junction formation via claudin-5 and zonula occludens-1 .

Potential Therapeutic Implications

  • Cancer: ZIP9 is upregulated in malignant breast and prostate tissues, making it a potential therapeutic target .

  • Reproductive Health: Regulates testosterone signaling in Sertoli and spermatogenic cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Slc39a9; Zip9; Zinc transporter ZIP9; Solute carrier family 39 member 9; Zrt- and Irt-like protein 9; ZIP-9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Slc39a9
Target Protein Sequence
MDDFLSISLLSLAMLVGCYVAGIIPLAVNFSEERLKLVTVLGAGLLCGTALAVIVPEGVH ALYEEVLEGKHHQASEAKQNVIASDKAAEISVVHEHEHSHDHTQLHAYIGVSLVLGFVFM LLVDQIGSSHVHSTDDPESARPSSSKITTTLGLVVHAAADGVALGAAASTSQTSVQLIVF VAIMLHKAPAAFGLVSFLMHAGLERNRIRKHLLVFALAAPAMSMLTYLGLSKSSKEALSE VNATGVAMLFSAGTFLYVATVHVLPEDTSTNQSGSSLSPRPLPSGKN
Uniprot No.

Target Background

Function
May function as a zinc influx transporter.
Database Links
Protein Families
ZIP transporter (TC 2.A.5) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structural organization and primary function of ZIP9 (SLC39A9)?

    ZIP9 is a member of the ZIP (ZRT-and Irt-like Protein) family of zinc transporters, specifically belonging to subfamily I, which is distinct from the other three subfamilies (II, LIV-1, and gufA). Human ZIP9 has a molecular weight of approximately 32-33 kDa and consists of 307 amino acids organized into 8 transmembrane domains with extracellular C-termini . This protein has a dual function: it regulates zinc homeostasis by transporting zinc across cell and organelle membranes into the cytoplasm, and it also serves as a membrane androgen receptor (mAR) .

    The protein is primarily localized to the trans-Golgi network regardless of zinc status, as demonstrated by confocal microscopy studies using HA-tagged human ZIP9 . Its main function appears to be regulating zinc homeostasis specifically in the secretory pathway, rather than altering cytosolic zinc levels directly . This localization suggests ZIP9 participates in zinc ion efflux out of secretory compartments into the cytoplasm .

    CharacteristicDetails for ZIP9 (SLC39A9)
    Molecular Weight32-33 kDa
    Length307 amino acids
    Transmembrane Domains8
    SubfamilyZIP subfamily I (only member in vertebrates)
    Primary LocalizationTrans-Golgi network
    Main FunctionsZinc transport, Membrane androgen receptor
  • How does ZIP9 expression vary across tissues and what methodologies are most effective for detecting it?

    ZIP9 is widely expressed across different human tissues, with notable expression in reproductive tissues including breast, prostate, ovary, and testis, as well as in the brain and thyroid . Expression levels appear to be regulated by reproductive hormones, as evidenced by upregulation in the ovary by these hormones . In pathological contexts, ZIP9 expression is upregulated in malignant breast and prostate tissues compared to normal controls .

    For detection of ZIP9, multiple methodological approaches have proven effective:

    Immunohistochemistry (IHC): Rabbit polyclonal antibodies against ZIP9 have been successfully used at 1:50 dilution for IHC on paraffin-embedded formalin-fixed tissues . Positive staining has been demonstrated in human thyroid tissue, with lower expression in pancreatic tissue .

    Western Blotting: Using anti-ZIP9 antibodies at 0.4 μg/mL concentration has been effective for detecting both endogenous and overexpressed ZIP9 protein . Custom polyclonal antibodies raised against synthetic peptides derived from the first extracellular loop of human ZIP9 (such as the 14-mer peptide AEKSVVHEHEHSDC) have been used at 1:2000 dilution with good results .

    RT-PCR and qPCR: For mRNA detection, specific primers targeting ZIP9 have been successfully employed:

    • Forward: 5′-TGGTGGGATGTTATGTGGCA-3′

    • Reverse: 5′-GTGGTGACCGACGGACAG-3′

    Subcellular Localization: Confocal microscopy of transiently expressed, HA-tagged human ZIP9 has been effective for determining its precise localization, particularly when co-stained with organelle markers like TGN58 for the trans-Golgi network .

  • What techniques are most reliable for studying ZIP9-mediated zinc transport activity?

    Several methodological approaches have been validated for investigating ZIP9's zinc transport function:

    Zinc Fluorescent Probes: ZinPyr-1 has been successfully employed to measure changes in Zn²⁺ concentration in the secretory pathway following ZIP9 manipulation . This approach allows visualization of zinc accumulation in ZIP9 knockout cells and can be quantified through fluorescence intensity measurements.

    Alkaline Phosphatase Activity Assays: As a zinc-dependent enzyme active in the secretory pathway, alkaline phosphatase activity serves as an indirect readout of ZIP9 function. Studies have shown that disruption of the ZIP9 gene affects how cells respond to zinc deficiency, as measured by changes in alkaline phosphatase activity . Under normal zinc levels, wild-type and ZIP9⁻/⁻ cells show similar enzyme activity, but when cultured in zinc-deficient medium, the decreased activity is less pronounced in ZIP9⁻/⁻ cells .

    Radioactive Zinc Uptake: Measuring the uptake of ⁶⁵Zn has been used to assess zinc transport activity, though this approach may be less specific for ZIP9 unless combined with genetic manipulation of ZIP9 expression.

    Testosterone-Induced Zinc Flux: Since testosterone binding to ZIP9 triggers increases in intracellular free zinc, measuring zinc levels following testosterone treatment provides insights into ZIP9's zinc transport function. This can be coupled with ZIP9 siRNA treatment to confirm specificity .

    These methodologies can be complemented by genetic manipulation of ZIP9 expression (overexpression or knockout) to establish causality between ZIP9 activity and observed changes in zinc homeostasis.

  • How can researchers effectively generate and validate ZIP9 knockout or overexpression models?

    Several approaches have been validated for modulating ZIP9 expression in experimental models:

    CRISPR-Cas9 Gene Editing: Lentiviral delivery of doxycycline-inducible Cas9 and gRNAs targeting exon 1 of SLC39A9 has proven effective. The following gRNA sequences have been successfully used :

    • hZIP9_gRNA_Fw: 5'-caccgTTGGTGGGATGTTACGTGGC-3'

    • hZIP9_gRNA_Rv: 5'-aaacGCCACGTAACATCCCACCAAC-3'

    • Alternative gRNAs: 5'-caccgCGTGGCCGGAATCATTCC-3' and 5'-aaacGGAATGATTCCGGCCACG-3'

    After transduction, cells should be selected with puromycin, and single-cell clones isolated and expanded. Validation of knockout should include both genomic verification and protein expression analysis.

    siRNA Knockdown: For transient suppression of ZIP9 expression, the following siRNA mixture has been effective :

    • AUGGGAGUUACCAAUCUGG

    • CCAGAUUGGUAACUCCCAU

    • GCUUAGAGCGGAAUCGAAU

    • AUUCGAUUCCGCUCUAAGC

    Typically, cells are transfected using Lipofectamine 2000 in antibiotic-free medium, with nonsense primers as negative controls.

    Stable Overexpression: ZIP9 has been successfully overexpressed in cell lines with low endogenous expression (such as PC-3 prostate cancer cells) . For localization studies, HA-tagged versions (hZIP9-HA) have proven particularly useful .

    Validation Methods:

    • RT-PCR and qPCR for mRNA expression

    • Western blotting for protein levels

    • Functional assays measuring zinc transport or testosterone binding

    • Downstream signaling assessments (G-protein activation, MAPK pathway activation)

    When generating knockout models, it's important to include control clones isolated in parallel without gene editing treatment to account for clonal variation.

  • How does the evolutionary conservation of ZIP9 compare with other zinc transporters across species?

    ZIP9 shows remarkable evolutionary conservation across vertebrate species, reflecting its fundamental importance in zinc homeostasis. Human ZIP9 shares high sequence identity with mammalian orthologs, including 84% identity with both mouse and rat ZIP9 . This conservation extends beyond mammals, with Atlantic croaker ZIP9 showing 81-93% amino acid sequence identity with ZIP9 (SLC39A9) subfamily members across vertebrate species .

    This level of conservation is notable because ZIP9 is the only member of the ZIP transporter subfamily I in vertebrates, distinguishing it from the other three subfamilies (II, LIV-1, and gufA) . The conserved features include the eight transmembrane domains and specific motifs critical for zinc binding and transport.

    The conservation of ZIP9's dual functionality as both a zinc transporter and membrane androgen receptor across species suggests this represents an evolutionarily ancient mechanism coupling steroid hormone signaling with zinc homeostasis. Experiments with ZIP9 from different species have confirmed functional conservation, with both human and Atlantic croaker ZIP9 demonstrating similar testosterone binding characteristics and signaling pathways .

    This conservation makes ZIP9 unique among zinc transporters and suggests it plays non-redundant roles that cannot be compensated by other members of the ZIP family, despite their shared zinc transport capabilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.