Recombinant Rattus rattus Probable G-protein coupled receptor 33 (Gpr33)

Shipped with Ice Packs
In Stock

Description

Evolutionary Context

  • Gpr33 originated in mammals ~125–190 million years ago but became a pseudogene in humans and some rodents due to selective pressures .

  • In rats (Rattus norvegicus), Gpr33 inactivation occurred <0.7 MYA and is now fixed globally .

Signaling Mechanisms

  • Constitutive Activity: Homologs like RCMV pR33 signal via Gαq/11 proteins, activating phospholipase C (PLC) without agonists .

  • Pathway Interactions: Hypothesized to modulate leukocyte chemotaxis and pathogen defense, though endogenous ligands remain unidentified .

Experimental Findings:

  • Viral Studies: Rat cytomegalovirus (RCMV) requires UL33-like GPCRs (e.g., R33) for salivary gland entry/replication, suggesting Gpr33 may influence viral pathogenesis .

  • Immune Modulation: Coevolution with pathogens likely drove pseudogenization, as intact receptors could increase susceptibility to infections .

GPCR Diversity in Rodents vs. Humans

MetricRat GPCRsHuman GPCRsMouse GPCRs
Total Full-Length1,8677991,783
Orthologs with Humans58%-70% (mouse)
Sequence Identity80% (vs. human), 90% (vs. mouse)

Rats exhibit expanded olfactory/vomeronasal GPCRs compared to humans, but Gpr33 belongs to the conserved Rhodopsin family .

Challenges & Future Directions

  • Ligand Identification: No physiological ligands confirmed despite homology to chemoattractant receptors .

  • Structural Data: No resolved 3D structures exist; computational modeling is needed to map binding pockets .

  • Pathological Relevance: Potential links to autoimmune/inflammatory diseases require validation using recombinant protein tools .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its inclusion.
Synonyms
Gpr33; Probable G-protein coupled receptor 33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Rattus rattus (Black rat)
Target Names
Target Protein Sequence
MDRVNSSGHVISVSPSLTNSTGVPTPAPKAIIAAALFMSFIVGTISNGLYLWMLKFKMQR TVNTLLFFHLILSYFISTLILPFMATSFLQDNHWAFGSVLCKVFNSTLSVSMFASVFFLS AISVDRYHLTLHPVWSQQHRTPRWASRIALRIWILATILSIPYLVFRETHDDHKGRIKCQ NNYIVGTNWESSEHQTLGQWIHAACFGRRFLLGFLLPFLVIVFCYKRVATKMKDKGLFKS SKPFKVMLTAVVSFFVCWMPYHVHSGLVLTKSQPLPSQLTLGLAVVTISFNTVVSPILYL FTGENFEVFKKSILALFKSTFSDSSATERTQTLNSETEI
Uniprot No.

Target Background

Function

Orphan receptor; potential chemoattractant receptor.

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is GPR33 and what is its evolutionary history in mammals?

GPR33 is an orphan G-protein coupled receptor that belongs to the chemokine-like receptor family. It first appeared in mammalian genomes approximately 125-190 million years ago and has since undergone independent pseudogenization in various species including humans, other hominoids, and some rodent species like rats and gerbils . In humans, a premature stop codon terminates the open reading frame after the third transmembrane domain, though the mRNA remains detectable in various tissues .

The simultaneous inactivation of GPR33 across unrelated species within the last million years is statistically unlikely to have occurred through neutral drift alone, suggesting selective pressure . One hypothesis proposes that GPR33 inactivation may have been advantageous as protection against a rodent-hominoid-specific pathogen, potentially explaining why it became a pseudogene in species that share habitats with disease vectors .

How is GPR33 expressed in different cell types?

GPR33 shows significant cell type-specific expression patterns. Research demonstrates that murine GPR33 is most highly expressed in dendritic cells, which are critical components of the innate immune system . Specifically, GPR33 mRNA expression is significantly enriched in CD11c+ dendritic cells compared to other immune cell populations, including B cells, T cells, NK cells, and macrophages .

The expression pattern of GPR33 overlaps with several chemokine receptors, but displays a more restricted cellular distribution. Transcript structure analysis reveals that GPR33 mRNA is transcribed from an intron-containing gene, although the coding sequence itself is intronless, with no evidence of splice variants . The exon-intron boundaries appear well conserved across mammalian species .

What methodologies are used for studying GPR33 expression?

Several methodological approaches have been validated for investigating GPR33 expression:

  • RACE PCR Analysis: Researchers use 5' RACE (Rapid Amplification of cDNA Ends) to determine transcriptional start sites of GPR33. This technique involves isolating mRNA from relevant tissues (e.g., bone marrow-derived dendritic cells), followed by the creation of full-length cDNA libraries that are then cloned and sequenced .

  • Quantitative PCR (qPCR): For quantifying GPR33 mRNA levels in different cell types or under various stimulation conditions, qPCR provides reliable results. Primers specific to GPR33 coding regions are designed to amplify the target sequence .

  • Flow Cytometry: For protein-level detection, flow cytometry combined with specific antibodies against GPR33 can be used to analyze expression on different cell populations .

  • In Vivo Expression Analysis: Administering TLR activators to model organisms and subsequently isolating RNA from relevant tissues (spleen, thymus, lymph nodes, lungs) allows for measurement of GPR33 expression under physiological conditions .

How is GPR33 transcription regulated in dendritic cells?

GPR33 transcription is primarily regulated through Toll-like receptor (TLR) activation and subsequent NF-κB and AP-1 signaling pathways. Experimental evidence demonstrates that various TLR activators significantly upregulate GPR33 expression in dendritic cells .

Stimulatory compounds and their effects on GPR33 expression:

CompoundTarget/PathwayEffect on GPR33 mRNA Expression
LPSTLR4 activatorSignificant increase
Poly I:CTLR3 activatorSignificant increase
R-848TLR7/8 activatorSignificant increase
Zymosan ATLR2/6 activatorSignificant increase
PMAAP-1/NF-κB activatorSignificant increase
ChloroquineAP-1/NF-κB pathwaySignificant increase
MnCl₂Signaling activatorModerate increase

Bioinformatic analysis of the GPR33 promoter region reveals multiple AP-1 and NF-κB transcription factor binding sites, supporting the role of these pathways in its regulation . Inhibitor studies using NF-κB inhibitors (celastrol, BAY) and AP-1 inhibitors (U-0126, NDGA) block the stimulation-induced upregulation of GPR33 mRNA, confirming the involvement of these signaling pathways .

Interestingly, cycloheximide, a protein synthesis inhibitor, rapidly blocks poly I:C-induced GPR33 expression, indicating that additional protein components ("early transcripts") induced by TLR activation are required for GPR33 transcription .

What is the role of GPR33 in viral infection response?

Evidence suggests that GPR33 plays a significant role in the antiviral immune response:

  • TLR3/TLR7 activation: Poly I:C (a TLR3 agonist that mimics viral double-stranded RNA) and R-848 (a TLR7 agonist that recognizes single-stranded viral RNA) strongly increase GPR33 expression both in vitro and in vivo . When administered to mice, these compounds significantly upregulate GPR33 expression in lymphoid organs, with the highest levels detected in spleen and lungs .

  • Viral homolog connection: The rat cytomegalovirus (RCMV) gene R33 encodes a G-protein-coupled receptor homolog that belongs to the same family as GPR33 and the human cytomegalovirus UL33 gene . This suggests evolutionary pressure from viral pathogens may have influenced GPR33 function.

  • Pathogenesis impact: Studies with a mutant RCMV strain (RCMVΔR33) with a disrupted R33 open reading frame showed that while viral replication in cell culture remained unaffected, the mutant strain induced significantly lower mortality in infected immunocompromised rats . Additionally, the mutant virus could not efficiently replicate in salivary gland epithelial cells, indicating the viral homolog's importance in pathogenesis .

These findings collectively position GPR33 as an early transcriptional target of the innate immune response to viral infection, potentially explaining the evolutionary selection pressure on this gene .

What experimental approaches can be used to generate and validate recombinant Rattus rattus GPR33?

Generation and validation of recombinant GPR33 requires several methodological steps:

  • Gene cloning:

    • PCR amplification of the GPR33 coding sequence from Rattus rattus genomic DNA

    • Cloning into an appropriate expression vector containing a strong promoter (CMV, EF1α)

    • Addition of affinity tags (His, FLAG, etc.) for purification and detection

  • Expression systems:

    • Mammalian cell lines (HEK293, CHO) for proper post-translational modifications

    • Baculovirus-insect cell system for higher protein yields

    • Cell-free expression systems for rapid screening

  • Protein purification:

    • Membrane extraction using detergents (DDM, LMNG, etc.)

    • Affinity chromatography using tag-specific resins

    • Size exclusion chromatography for final purification

  • Functional validation:

    • Ligand binding assays (if ligands are known)

    • G-protein coupling studies using [³⁵S]GTPγS binding

    • β-arrestin recruitment assays

    • Calcium mobilization assays

  • Structural characterization:

    • Circular dichroism spectroscopy to assess secondary structure

    • Thermal stability assays

    • Potentially X-ray crystallography or cryo-EM for detailed structure

Based on the challenges observed in the literature, expression of GPR33 may be difficult in certain cell types. Researchers have reported unsuccessful attempts to transfect dendritic cells with GPR33 promoter constructs, suggesting cell-specific requirements for proper expression . Alternative approaches using cell lines containing components of the NF-κB/AP-1 signaling cascades (COS-7, HEK293, CHO-K1, NIH/3T3) may be necessary .

How can gene disruption approaches be utilized to study GPR33 function in vivo?

Several gene disruption approaches can be employed to investigate GPR33 function:

  • CRISPR/Cas9 gene editing:

    • Design guide RNAs targeting exonic regions of GPR33

    • Generate knockout or knockin cell lines and animal models

    • Verify disruption through sequencing and functional assays

  • Viral vector-mediated gene disruption:

    • Similar to the approach used for RCMV R33, where plasmid-based homologous recombination was employed to disrupt the open reading frame

    • For the RCMV R33 study, electroporation (0.25 kV, 500 μF) was used to introduce the disruption construct into cells, followed by selection with G418

    • Plaque purification techniques can then isolate recombinant viruses

  • Antisense oligonucleotides and siRNA:

    • For temporary knockdown of GPR33 expression

    • Useful for studying acute effects without genetic compensation

  • Assessment of phenotypic effects:

    • Immune cell function assays (cytokine production, cell migration)

    • Pathogen challenge experiments

    • In the case of RCMV R33, immunocompromised rats (immunosuppressed by 5 Gy total-body irradiation) were infected with either wild-type or mutant virus, with mortality and virus replication in various organs measured

When studying gene function through disruption, it's critical to include appropriate controls and to verify the specificity of the disruption to avoid off-target effects.

What do population genetic studies reveal about GPR33 variation across human populations?

Population genetic analyses of GPR33 reveal interesting patterns of variation across different human populations:

  • Allele frequency distribution: The inactive, derived GPR33 stop allele (null-allele, pseudogene) shows significant differences in frequency among human populations. European populations show near fixation of the null-allele compared to African and Asian populations, which retain higher frequencies of the ancestral, intact allele .

  • Selection signatures: Tests for recent selection (iHS, Fst values) did not meet statistical significance, suggesting that recent selection (within the last 10-50 thousand years) on human GPR33 is unlikely . The pseudogenization of GPR33 is estimated to have occurred more than 50,000 years ago .

  • Geographic distribution patterns: There is a trend of elevated frequency of the ancestral CGA allele (intact GPR33) toward Asia . These significant differences in geographic allele distribution may indicate past selection or balancing selection, though they could also reflect the current status of genetic drift .

The pattern of independent pseudogenization in multiple species (humans, other hominoids, rats, gerbils) within a relatively short evolutionary timeframe strongly suggests selection pressure rather than neutral drift . The synchronization of GPR33 inactivation across unrelated rodent and primate species points to an advantage potentially related to pathogen resistance .

What methodological approaches are used to genotype GPR33 allelic variants?

Several methodological approaches have been validated for genotyping GPR33 allelic variants:

  • TaqMan allelic discrimination assay: This method was employed to genotype individuals from different populations at SNP rs17097921 (c.418T > C polymorphism), which represents the TGA (pseudogene) and CGA (intact gene) allelic variants of GPR33 .

  • HapMap SNP data analysis: Data from public repositories like the HapMap SNP data collections and Perlegen's reference genotype data (AFD panels) can be analyzed for population-level information on GPR33 variants .

  • Neutrality tests: Tests including Tajima's D, Fu and Li's D* and F* can be performed using software packages like DnaSP to determine whether selection is acting on the GPR33 locus .

  • Selection analysis tools: Tools such as Haplotter (http://hg-wen.uchicago.edu/selection/haplotter.htm) can be used to examine evidence for natural selection on the GPR33 locus by calculating metrics like iHS (a measure of recent positive selection), Fay and Wu's H, Tajima's D, and Fst in population-level data .

  • Sliding window analysis: This approach enables examination of selection signatures across genomic regions surrounding the GPR33 locus .

What cell culture systems are most appropriate for studying GPR33 function?

Based on the research findings, several considerations should be made when selecting cell culture systems for GPR33 research:

  • Dendritic cells: As the primary cell type expressing high levels of GPR33, bone marrow-derived dendritic cells represent an ideal physiological system . These cells can be generated from mouse bone marrow cultured with GM-CSF and IL-4 for 7-8 days .

  • Challenges with dendritic cells: Despite being the most physiologically relevant, dendritic cells present technical challenges. Attempts to transfect these cells with promoter constructs have been unsuccessful, limiting certain types of experimental manipulations .

  • Alternative cell lines: When transfection is required, cell lines containing components of the NF-κB/AP-1 signaling cascades should be considered:

    • COS-7

    • HEK293

    • CHO-K1

    • NIH/3T3

  • In vivo systems: For studying physiological regulation, in vivo systems remain valuable. Animal models allow for examination of GPR33 expression in response to TLR activators across different tissues .

What are the key stimuli and inhibitors for modulating GPR33 expression in experimental settings?

For researchers designing experiments to modulate GPR33 expression, the following compounds have demonstrated efficacy:

Stimulatory compounds:

CompoundConcentrationTarget/MechanismEffect on GPR33 mRNA
Poly I:C40 μg/mlTLR3 activator (mimics viral dsRNA)Strong increase
R-8481 μg/mlTLR7/8 activator (mimics viral ssRNA)Strong increase
LPS5 μg/mlTLR4 activatorSignificant increase
Zymosan A50 μg/mlTLR2/6 activatorSignificant increase
PMA25 ng/mlActivates protein kinase C, AP-1 pathwaySignificant increase
Chloroquine200 μMEndosomal inhibitor, activates AP-1/NF-κBSignificant increase
MnCl₂300 μMSignaling activatorModerate increase

Inhibitory compounds:

InhibitorConcentrationTarget/MechanismEffect
Celastrol250 nMNF-κB inhibitorBlocks stimulator-induced GPR33 expression
BAY100 μMNF-κB inhibitorBlocks stimulator-induced GPR33 expression
NDGA5 μMAP-1 inhibitorBlocks stimulator-induced GPR33 expression
U-012650 μMAP-1 inhibitor (MEK/ERK pathway)Blocks stimulator-induced GPR33 expression
Cycloheximide50 μg/mlProtein synthesis inhibitorRapidly blocks poly I:C-induced GPR33 expression

When designing stimulation experiments, researchers should consider the following:

  • Timing: GPR33 expression shows maximum levels at approximately 8 hours post-stimulation with poly I:C .

  • Pre-incubation: For inhibition studies, cells should be pre-incubated with inhibitors for 30 minutes before adding stimulatory compounds .

  • Cell type specificity: The effectiveness of these compounds may vary depending on the cell type used .

  • In vivo application: For animal studies, poly I:C and R-848 have proven effective when administered intraperitoneally or nasally, with the highest GPR33 expression observed in spleen and lungs .

What are common challenges in expressing recombinant GPR33 and how can they be addressed?

Researchers face several challenges when working with recombinant GPR33:

  • Cell-specific expression requirements: The literature indicates difficulties in achieving GPR33 expression in common laboratory cell lines. Attempts to express GPR33 using various promoter constructs in COS-7, HEK293, CHO-K1, and NIH/3T3 cells were unsuccessful . This suggests:

    • The need for cell-specific transcription factors

    • Potential requirement for precise chromatin context

    • Possible involvement of distal enhancer elements not included in typical constructs

    Solution: Use larger genomic fragments containing distal regulatory elements, or consider BAC (Bacterial Artificial Chromosome) transgenic approaches to maintain the native genomic context.

  • Membrane protein expression challenges: As a 7-transmembrane GPCR, GPR33 may face expression and folding challenges common to membrane proteins:

    • Toxicity due to overexpression

    • Protein aggregation

    • Improper folding and trafficking

    Solutions:

    • Use inducible expression systems to control expression levels

    • Incorporate fusion partners known to enhance GPCR expression (T4 lysozyme, BRIL)

    • Screen multiple detergents for optimal solubilization

    • Include chemical chaperones during expression

  • Lack of known ligands: As an orphan receptor, functional validation through ligand binding is challenging.

    Solutions:

    • Use functional assays that detect constitutive activity

    • Perform screening against compound libraries

    • Utilize bioinformatic approaches to predict potential ligands based on receptor homology

  • Dendritic cell transfection difficulties: The literature notes that "all attempts failed to transfect DC" .

    Solutions:

    • Use viral transduction methods (lentivirus, adenovirus) rather than transfection

    • Consider electroporation methods specifically optimized for dendritic cells

    • Explore newer transfection reagents designed for hard-to-transfect cells

How can researchers effectively validate GPR33 knockout or mutation models?

  • Genomic validation:

    • PCR-based genotyping to confirm the presence of the targeted mutation

    • Sequencing the target locus to verify precise genetic modifications

    • For large deletions, Southern blotting may provide additional confirmation

  • Transcript validation:

    • RT-PCR to confirm absence or alteration of the transcript

    • qPCR to quantify any residual expression

    • RNA-seq to assess potential alternative splicing or compensatory changes

  • Protein validation:

    • Western blotting with validated antibodies (if available)

    • Immunohistochemistry to confirm loss of protein in relevant tissues

    • Flow cytometry for cell-surface expression analysis

  • Functional validation:

    • TLR-stimulation response assays to confirm altered GPR33 expression dynamics

    • Assessment of downstream signaling pathways

    • Challenge with pathogens to observe phenotypic differences similar to those seen in the RCMV R33 model

  • Controls to include:

    • Wild-type controls from the same genetic background

    • Heterozygous animals to assess gene dosage effects

    • Mock-treated controls for any treatment conditions

    • For CRISPR/Cas9 approaches, include controls with non-targeting guide RNAs

  • Off-target effect assessment:

    • Sequence potential off-target sites predicted by bioinformatic algorithms

    • Perform whole-genome sequencing on a subset of mutant lines

    • Include rescue experiments by reintroducing wild-type GPR33 to confirm phenotype specificity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.