Recombinant Red clover mottle virus RNA1 polyprotein

What is the structure and function of Red clover mottle virus RNA1 polyprotein?

The Red clover mottle virus (RCMV) RNA1 polyprotein is a multifunctional protein encoded by RNA1 of the viral genome. It is processed into several functional proteins through proteolytic cleavage, including:

• Protease cofactor

• 32 kDa protein

• Putative helicase (EC 3.6.4.-)

• VPg (Viral Protein genome-linked)

• RNA-dependent RNA polymerase (RdRP)

The full-length mature protein (residues 1152-1864) contains key domains necessary for viral replication. The polyprotein plays crucial roles in viral RNA replication and potentially in suppressing host RNA silencing mechanisms, similar to what has been observed in related viruses like Red clover necrotic mosaic virus (RCNMV) .

The amino acid sequence contains functional motifs typical of positive-strand RNA virus replicases, including NTP-binding domains and RdRP catalytic regions essential for viral genome replication .

How do Red clover mottle virus (RCMV) and Red clover necrotic mosaic virus (RCNMV) differ in genome organization?

These are two distinct plant viruses affecting red clover, with important differences:

RCMV is more closely related to Cowpea mosaic virus (CPMV), while RCNMV has distinct replication mechanisms and gene expression strategies .

What expression systems are commonly used for producing recombinant RCMV RNA1 polyprotein?

Several expression systems have been employed to produce recombinant RCMV RNA1 polyprotein for research purposes:

• E. coli expression system: Most commonly used for producing His-tagged recombinant proteins for structural and functional studies. The polyprotein or specific domains can be expressed with N-terminal or C-terminal His-tags to facilitate purification .

• Yeast expression systems: Used when post-translational modifications might be important for protein function.

• Baculovirus/insect cell system: Preferred when higher eukaryotic processing is required for proper protein folding and function.

• Mammalian cell expression: Can be used for studies requiring mammalian-specific post-translational modifications.

For functional studies, researchers typically use E. coli systems as they provide high yields and simplified purification protocols. The recombinant proteins are commonly stored in Tris/PBS-based buffers with 6% trehalose at pH 8.0, and aliquoted with 5-50% glycerol for long-term storage at -20°C or -80°C to maintain stability and prevent repeated freeze-thaw cycles .

What methodologies are most effective for studying the RNA-dependent RNA polymerase activity of RCMV RNA1 polyprotein?

To effectively study the RNA-dependent RNA polymerase (RdRP) activity of RCMV RNA1 polyprotein, researchers employ several specialized techniques:

• In vitro RdRP assays: Using purified recombinant polyprotein or the RdRP domain specifically, researchers can assess enzymatic activity by measuring the incorporation of radiolabeled nucleotides into RNA products. This typically involves:

  • Incubating the purified polymerase with template RNA

  • Adding ribonucleotide triphosphates (including a radiolabeled NTP)

  • Analyzing the RNA products by gel electrophoresis

• Blue-native polyacrylamide gel electrophoresis (BN-PAGE): This technique has been valuable for studying replicase complex formation in related viruses like RCNMV, where a 480-kDa complex with RNA-dependent RNA polymerase activity was identified. Similar approaches could be applied to RCMV .

• Reconstitution of replication complexes: By combining recombinant viral proteins with synthetic RNA templates containing viral replication elements, researchers can reconstitute and study functional replication complexes in vitro.

• RNA binding assays: Electrophoretic mobility shift assays (EMSA) or filter-binding assays can be used to characterize the RNA-binding properties of the polyprotein, which are critical for replication activity.

Studies with related viruses suggest that protein-protein interactions are essential for forming functional replication complexes with polymerase activity . Therefore, co-expression of additional viral factors may be necessary to observe optimal enzymatic activity.

How do protein-protein interactions influence RCMV RNA1 polyprotein function in viral replication?

Protein-protein interactions are fundamental to the function of RCMV RNA1 polyprotein in viral replication, as evidenced by studies on related viruses like RCNMV:

• Complex formation: In RCNMV, interactions between p27 and p88 replicase proteins (analogous to products of RNA1 polyprotein processing in RCMV) are essential for forming a 480-kDa replication complex with RNA-dependent RNA polymerase activity .

• Domains mediating interactions: Specific domains within viral replicase proteins mediate these critical interactions. In RCNMV, researchers have identified domains in p27 and p88 responsible for protein-protein interactions using in vitro pull-down assays with purified recombinant proteins .

• Functional consequences: There is a strong correlation between complex formation and both replication efficiency and RNA silencing suppression activity. Mutations that disrupt these protein-protein interactions significantly reduce viral replication .

• Methodology for study: Co-immunoprecipitation analysis combined with blue-native polyacrylamide gel electrophoresis has been effective in studying these interactions. Similar approaches could be applied to study RCMV RNA1 polyprotein interactions .

• Membrane association: The replication complexes associate with host cell membranes, forming viral replication factories. Protein-protein interactions between viral components and host factors are likely crucial for this process .

Understanding these interactions could provide targets for antiviral strategies and insights into fundamental aspects of positive-strand RNA virus replication.

What RNA elements interact with RCMV RNA1 polyprotein during viral replication?

Several RNA elements are critical for interaction with RCMV RNA1 polyprotein during viral replication:

• 3′ Untranslated Region (UTR): The 3′ UTR of RCMV RNA1 likely contains primary sequence elements and secondary structures that function as recognition sites for the viral replicase. In related viruses like RCNMV, the 3′ UTR functions as a determinant of temperature-sensitive viral RNA accumulation .

• Stem-Loop Structures: Specific stem-loop structures within viral RNAs serve as cis-acting elements for RNA replication. In RCNMV, elements like SL2 play dual roles as trans-activators for subgenomic RNA synthesis and cis-acting elements for RNA2 replication .

• RNA-RNA Interactions: Base-pairing interactions between different viral RNA molecules can create structures recognized by the replicase complex. In RCNMV, RNA-RNA interactions between RNA1 and RNA2 are essential for subgenomic RNA synthesis but not required for RNA2 replication .

• Cap-Independent Translation Elements: These elements in the RCMV RNA may interact with the polyprotein or its processed products during the switch from translation to replication. In RCNMV, the 3′ UTR of RNA1 functions as a cap-independent translational enhancer .

• Viral Protein genome-linked (VPg) attachment sites: Specific sequences where VPg (a product of RNA1 polyprotein) becomes covalently linked to the viral RNA. In RCMV, RNA is polyadenylated and has VPg covalently linked to its 5′ terminus .

Methodological approaches to study these interactions include RNA structure probing, RNA footprinting, RNA immunoprecipitation, and mutational analysis of viral RNAs followed by replication assays.

What structural features distinguish the RNA-dependent RNA polymerase domain of RCMV from other viral polymerases?

The RNA-dependent RNA polymerase (RdRP) domain of RCMV RNA1 polyprotein possesses several distinctive structural features:

• Conserved Motifs: The RdRP domain contains canonical palm, fingers, and thumb subdomains with eight conserved motifs (A-H) typical of positive-strand RNA virus polymerases. Particularly important are motifs A, B, and C in the palm subdomain, which form the catalytic core for nucleotide addition .

• Sequence-Specific Features: Analysis of the amino acid sequence (GAEKYFNFYPIEYDAAEGIARVGELKPKLYIPLPKKTSLVKTPEEWHLGTPCDKVPSILV...) reveals regions unique to RCMV compared to other viral polymerases, particularly in the loops connecting the conserved structural elements .

• Co-factor Binding Sites: The polymerase domain likely contains specific binding sites for metal ions (typically Mg²⁺) essential for catalytic activity and NTP binding pockets with virus-specific characteristics.

• Protein-Protein Interaction Interfaces: Based on studies of related viruses, the RdRP domain contains surfaces that interact with other viral proteins to form functional replication complexes .

• RNA Recognition Elements: Specific structural features that recognize viral RNA templates, including potential interactions with the 3′ UTR of viral RNAs.

To study these structural features, researchers employ X-ray crystallography, cryo-electron microscopy, protein modeling based on related viral polymerases, and mutational analysis coupled with functional assays. Comparative analysis with other comovirus polymerases, such as those from Cowpea mosaic virus (CPMV), provides insights into virus-specific structural adaptations .

How can researchers optimize expression and purification protocols for obtaining functionally active recombinant RCMV RNA1 polyprotein?

Optimizing expression and purification of functionally active recombinant RCMV RNA1 polyprotein requires addressing several critical factors:

Expression Optimization:

• Codon Optimization: Adapt the viral gene sequence to the codon usage bias of the expression host (E. coli, yeast, etc.) to enhance translation efficiency.

• Expression Constructs:

  • For full-length polyprotein: Use strong inducible promoters (T7, tac) with optimal ribosome binding sites

  • For functional domains: Design constructs expressing specific domains (e.g., RdRP domain) with appropriate boundaries based on predicted secondary structure

  • Include fusion tags (His, GST, MBP) positioned to minimize interference with folding

• Expression Conditions:

  • Test various induction parameters (temperature, inducer concentration, duration)

  • Lower temperatures (16-20°C) often favor proper folding of large viral proteins

  • Consider co-expression with molecular chaperones (GroEL/ES, DnaK/J) to enhance solubility

Purification Strategy:

• Lysis and Solubilization:

  • Optimize buffer composition (pH 7.5-8.5, 300-500 mM NaCl, 5-10% glycerol)

  • Include stabilizing agents (trehalose, arginine, glutamate)

  • For membrane-associated domains, evaluate detergents (DDM, CHAPS) or amphipols

• Chromatography Sequence:

  • Initial capture: IMAC (for His-tagged proteins)

  • Intermediate purification: Ion exchange chromatography

  • Polishing: Size exclusion chromatography to isolate monomeric protein

  • Consider on-column refolding for proteins recovered from inclusion bodies

• Quality Assessment:

  • SDS-PAGE for purity (aim for >90%)

  • Dynamic light scattering to evaluate aggregation state

  • Thermal shift assays to assess stability and identify stabilizing buffer conditions

• Activity Preservation:

  • Store purified protein in Tris/PBS buffer with 6% trehalose

  • Add glycerol (final concentration 30-50%) for long-term storage

  • Aliquot and flash-freeze to avoid repeated freeze-thaw cycles

• Functional Validation:

  • RNA binding assays (filter binding, EMSA)

  • In vitro RdRP activity assays using synthetic RNA templates

  • Co-purification with known interaction partners to form functional complexes

Researchers working with related viruses have found that co-expression of multiple viral proteins can sometimes be necessary to obtain stable, functionally active replicase complexes .

What experimental approaches can be used to study the role of RCMV RNA1 polyprotein in suppressing host RNA silencing?

Studying the role of RCMV RNA1 polyprotein in RNA silencing suppression requires specialized experimental approaches:

• Agrobacterium-mediated transient expression assays:

  • Co-infiltrate leaves with constructs expressing GFP (reporter), GFP-specific dsRNA (silencing inducer), and RCMV RNA1 polyprotein or its domains

  • Quantify GFP fluorescence/protein levels to assess silencing suppression

  • Include known suppressors (p19, HC-Pro) as positive controls

• In vitro biochemical assays:

  • siRNA binding assays: Use gel mobility shift assays to test if the polyprotein or specific domains bind to small RNAs

  • Dicer inhibition assays: Determine if the polyprotein inhibits processing of dsRNA by recombinant Dicer

  • RISC loading/activity assays: Test interference with ARGONAUTE loading or slicer activity

• Small RNA profiling:

  • Compare small RNA populations in plants infected with wild-type virus versus those infected with mutants defective in silencing suppression

  • Use high-throughput sequencing to analyze changes in abundance and size distribution of viral and host small RNAs

• Protein-protein interaction studies:

  • Identify interactions between the polyprotein and components of the RNA silencing machinery (DCL, AGO, RDR proteins)

  • Methods include co-immunoprecipitation, yeast two-hybrid, and bimolecular fluorescence complementation

• Structure-function analysis:

  • Generate a series of deletion/point mutations in the polyprotein

  • Test each mutant for silencing suppression activity

  • Correlate suppression activity with other functions (RNA binding, replication complex formation)

• Subcellular localization studies:

  • Determine if the polyprotein co-localizes with components of the silencing machinery

  • Use confocal microscopy with fluorescently tagged proteins

Studies with the related RCNMV have shown that interactions between p27 and p88 replicase proteins are essential for RNA silencing suppression, with a strong correlation between the accumulated levels of the 480-kDa replication complex and suppression activity . Similar mechanisms might operate in RCMV, suggesting that replication complex formation and silencing suppression are functionally linked.

How do mutations in specific domains of RCMV RNA1 polyprotein affect viral pathogenicity and host range?

The relationship between RCMV RNA1 polyprotein mutations and viral pathogenicity/host range involves complex mechanisms that can be studied through several experimental approaches:

• Reverse Genetics Analysis:

  • Generate infectious clones with specific mutations in different domains of the RNA1 polyprotein

  • Introduce mutations in:

    • Protease domains (affecting polyprotein processing)

    • Helicase motifs (affecting RNA unwinding)

    • RdRP catalytic sites (affecting replication fidelity/efficiency)

    • Protein-protein interaction interfaces

  • Assess impacts on viral accumulation, symptom development, and host range

• Temperature Sensitivity Studies:

  • Identify mutations that confer temperature sensitivity

  • The 3′ UTR of related RCNMV RNA1 functions as a determinant of temperature-sensitive viral RNA accumulation , suggesting interactions with the polyprotein

• Cross-Protection and Pseudorecombination Experiments:

  • Generate pseudorecombinant viruses by exchanging RNA segments between RCMV strains

  • Similar to studies with RCNMV strains S and O, which formed viable pseudorecombinants useful for mapping symptom and host range determinants

• Host Factor Interaction Analysis:

  • Compare how wild-type and mutant polyproteins interact with host factors

  • Changes in these interactions often correlate with altered pathogenicity

• Transmission Studies:

  • Assess how mutations affect vector transmission efficiency

  • Particularly relevant for plant-to-plant spread in field conditions

Specific domains often correlate with distinct pathogenicity features:

• Mutations in the RdRP domain may affect replication fidelity, potentially generating quasispecies with altered host adaptation

• Changes in protein-protein interaction domains could alter the virus's ability to form effective replication complexes in specific host backgrounds

• Mutations affecting RNA silencing suppressor activity could dramatically impact host range, as silencing represents a primary host defense mechanism