Recombinant Regulator of sigma E protease (rseP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
rseP; Z0187; ECs0178; Regulator of sigma E protease; S2P endopeptidase; Site-2 protease RseP; S2P protease RseP; Site-2-type intramembrane protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
rseP
Target Protein Sequence
MLSFLWDLASFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYV IALIPLGGYVKMLDERAEPVVPELRHHAFNNKSVGQRAAIIAAGPVANFIFAIFAYWLVF IIGVPGVRPVVGEIAANSIAAEAQIAPGTELKAVDGIETPDWDAVRLQLVDKIGDESTTI TVAPFGSDQRRDVKLDLRHWAFEPDKEDPVSSLGIRPRGPQIEPVLENVQPNSAASKAGL QAGDRIVKVDGQPLTQWVTFVMLVRDNPGKSLALEIERQGSPLSLTLIPESKPGNGKAIG FVGIEPKVIPLPDEYKVVRQYGPFNAIVEATDKTWQLMKLTVSMLGKLITGDVKLNNLSG PISIAKGAGMTAELGVVYYLPFLALISVNLGIINLFPLPVLDGGHLLFLAIEKIKGGPVS ERVQDFCYRIGSILLVLLMGLALFNDFSRL
Uniprot No.

Target Background

Function

Recombinant Regulator of sigma E protease (RseP) is a site-2 regulated intramembrane protease (S2P) that cleaves the peptide bond between Ala-108 and Cys-109 within the transmembrane region of RseA. It is a component of the regulated intramembrane proteolysis (RIP) cascade. RseP acts on DegS-cleaved RseA, releasing the cytoplasmic domain of RseA. This proteolytic event facilitates cellular sigma-E (RpoE) activity.

Database Links

KEGG: ece:Z0187

STRING: 155864.Z0187

Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is RseP and what is its role in regulated intramembrane proteolysis?

RseP functions as a Site-2 protease (S2P) that plays a crucial role in regulated intramembrane proteolysis (RIP), a signaling mechanism conserved from bacteria to humans. In bacterial systems, particularly Escherichia coli, RseP cleaves the transmembrane protein RseA within the lipid bilayer, but only after initial cleavage by the Site-1 protease DegS. This sequential proteolytic cascade is essential for stress response signaling pathways that control gene expression under various environmental challenges .

The proteolysis mediated by RseP occurs within the membrane, targeting specific residues of the transmembrane domain of its substrate. This intramembrane cleavage ultimately results in the release of signaling molecules that can activate transcription factors, leading to altered gene expression patterns in response to cellular stressors. Unlike many proteases that function in aqueous environments, RseP has evolved specialized mechanisms to catalyze peptide bond hydrolysis within the hydrophobic environment of the lipid bilayer .

Why must Site-1 proteases like DegS act before RseP cleavage can occur?

The requirement for sequential proteolysis where DegS must act before RseP is not arbitrary but represents a carefully regulated molecular mechanism. Research has definitively demonstrated that after DegS cleaves RseA (the Site-1 cleavage), the newly exposed carboxyl-terminal residue Val-148 of RseA plays an essential role in facilitating subsequent RseP cleavage. Experimental evidence shows that mutation of this Val-148 residue to charged or dissimilar amino acids significantly impairs the Site-2 cleavage activity .

Interestingly, the identity of residues 146 and 147 of RseA has no significant impact on Site-2 cleavage, highlighting the specificity of this recognition mechanism. This sequential requirement ensures that RseP-mediated signaling is tightly controlled and only activated under appropriate conditions. Structural analyses suggest that after DegS cleavage, the newly exposed carboxyl terminus of RseA may facilitate Site-2 cleavage through direct interaction with the PDZ domain of RseP, explaining at the molecular level why Site-1 cleavage must precede Site-2 cleavage .

How should I design experiments to reconstitute RseP activity in vitro?

When designing experiments to reconstitute RseP activity in vitro, several methodological considerations are essential. First, establish a reliable system that maintains the membrane environment necessary for RseP function. Typically, this involves using purified recombinant RseP incorporated into liposomes or nanodiscs that mimic the native lipid bilayer context. The experimental approach should allow for controlled sequential proteolysis, first by DegS (or a pre-cleaved substrate) followed by RseP .

For robust experimental design:

  • Include appropriate controls for each experimental variable

  • Systematically manipulate independent variables (e.g., substrate concentration, membrane composition)

  • Measure dependent variables precisely (e.g., cleavage efficiency, product formation)

  • Control extraneous variables that might affect enzymatic activity

When reconstituting the system, it is critical to verify that your recombinant RseP retains its native conformation and activity. This can be accomplished through activity assays using known substrates with defined cleavage sites. Additionally, prepare RseA substrates that either mimic pre-cleaved states or establish a complete two-step system with DegS followed by RseP cleavage .

What controls are essential when studying RseP's proteolytic activity?

When investigating RseP's proteolytic activity, implementing comprehensive controls is crucial for generating reliable and interpretable data. Essential controls include:

  • Negative enzyme controls: Include reactions without RseP to establish baseline substrate stability.

  • Catalytic site mutants: Use RseP variants with mutations in the catalytic residues to confirm that observed proteolysis is specifically due to RseP activity.

  • PDZ domain mutants: Include RseP variants with modified PDZ domains, particularly the second PDZ domain, to evaluate the role of these domains in substrate recognition.

  • Substrate variants: Test multiple substrate variants, including those with mutations at the Val-148 position of RseA (post-DegS cleavage), to validate the specificity of the cleavage mechanism .

  • Time-course experiments: Perform kinetic analyses to establish the temporal relationship between substrate binding and cleavage.

How can I optimize experimental conditions for studying RseP-substrate interactions?

Optimizing experimental conditions for studying RseP-substrate interactions requires systematic evaluation of multiple parameters. Begin by determining the ideal detergent or lipid composition that maintains RseP in its native conformation while allowing for efficient substrate access. Different detergents may affect RseP activity differently, so testing a panel of detergents (e.g., DDM, LMNG, or GDN) at various concentrations is advisable.

Temperature and pH significantly impact enzyme-substrate interactions and should be methodically optimized. Conduct experiments across a temperature range (typically 25-37°C) and pH range (pH 6.5-8.0) to identify conditions that maximize RseP activity while maintaining physiological relevance. Additionally, evaluate the impact of various ions and cofactors, as metalloproteases like RseP often require specific metal ions for optimal activity.

When designing such optimization experiments, employ a structured approach:

  • Use factorial experimental designs to systematically test combinations of conditions

  • Include both positive and negative controls in each experimental series

  • Maintain consistent substrate preparation methods to minimize variability

  • Implement quantitative readouts for precise measurement of interaction parameters

The granularity of your treatment conditions should be sufficiently detailed to capture subtle effects on RseP-substrate interactions, while remaining manageable in scope. Statistical evaluation of replicate experiments will help identify truly optimal conditions versus those that produce variability in outcomes .

How should I analyze data from RseP cleavage site mapping experiments?

Analyzing data from RseP cleavage site mapping experiments requires rigorous methodology to ensure accurate identification of genuine cleavage sites. Begin with comprehensive sample preparation that preserves the integrity of cleavage products. Mass spectrometry-based approaches offer high resolution for identifying precise cleavage sites, but proper data analysis is critical.

When analyzing mass spectrometry data:

  • Implement stringent quality control filters to minimize false positives

  • Use multiple search algorithms to cross-validate identified cleavage sites

  • Establish clear criteria for distinguishing specific RseP cleavage events from background proteolysis

  • Apply appropriate statistical methods to evaluate the confidence of identified sites

For gel-based analyses of cleavage products, densitometry should be performed with proper normalization to loading controls. When comparing wild-type RseP activity to mutant variants or different experimental conditions, statistical analysis must account for both biological and technical variability .

What statistical approaches are recommended for analyzing RseP mutation studies?

  • Paired analysis approaches: When testing the same substrate under identical conditions with different RseP variants, paired t-tests or repeated measures ANOVA may be appropriate, depending on the number of variants being compared.

  • Multiple comparison corrections: When testing numerous mutations simultaneously, apply corrections such as Bonferroni or false discovery rate adjustments to control for inflated Type I error rates.

  • Regression analysis: For studying the relationship between specific amino acid properties (e.g., hydrophobicity, charge) and enzymatic activity, regression models can identify significant correlations and quantify their strength.

  • Non-parametric methods: If your data violate assumptions of normality, consider non-parametric alternatives such as the Mann-Whitney U test or Kruskal-Wallis test.

It's crucial to distinguish between statistical significance and biological significance. A mutation that produces a statistically significant change in activity may not necessarily represent a biologically meaningful alteration. Consider the magnitude of effects alongside statistical significance when interpreting results .

Additionally, when analyzing complex datasets with multiple variables, avoid the temptation to adjust your analytical approach post-hoc based on initial findings. Pre-register your analytical plan before conducting experiments to maintain methodological integrity. If your experimental design changes during implementation, clearly document these alterations and account for them in your analysis .

What are the best practices for presenting RseP research data in publications?

Presenting RseP research data effectively in publications requires thoughtful consideration of both content and format. When creating figures and tables:

  • Include only necessary graphical elements: Add graphs only if they improve the reader's ability to understand your findings. Avoid redundancy between text, tables, and figures .

  • Design figures that convey immediate visual impressions: Ensure that your figures give an instant understanding of the data patterns. For example, when comparing wild-type and mutant RseP activity, use consistent color schemes and clear visual hierarchies .

  • Provide complete figure legends: Ensure that legends contain all necessary information for interpretation without referring to the main text .

RseP VariantRelative Activity (%)Substrate SpecificityPDZ Interaction
Wild-type100 ± 5HighStrong
ΔPDZ215 ± 3ReducedAbsent
Val-148-Glu8 ± 2MinimalWeak
His-catalytic<2UndetectableStrong

Table 1: Comparative analysis of RseP variants showing relative proteolytic activity, substrate specificity, and PDZ domain interactions. Values represent means ± SD from three independent experiments.

For Kaplan-Meier survival curves or time-course experiments tracking RseP activity, include the number of samples at each time point in a risk table below the figure. Avoid cluttering figures with excessive gridlines or labels that distract from the data. When presenting distribution data, consider adding violin plots or box plots alongside regression lines to show both trends and data dispersion .

Ensure that all quantitative data presented in figures is also reported numerically in the text or tables, allowing readers to access the precise values. Statistical significance should be clearly indicated using consistent notation throughout the manuscript .

How do the structural features of RseP's PDZ domains contribute to substrate recognition?

The PDZ domains of RseP play a crucial role in substrate recognition and specificity. Structural analyses reveal that the second PDZ domain (PDZ2) of RseP contains a putative peptide-binding groove that appears specifically configured for binding to a single hydrophobic amino acid, such as the exposed Val-148 residue of RseA after DegS cleavage. In contrast, the first PDZ domain (PDZ1) does not show similar structural features for this specific binding mode .

The PDZ2 domain likely functions as a molecular sensor that detects the newly exposed carboxyl terminus created by Site-1 proteases. This recognition mechanism explains why RseP activity depends on prior cleavage by DegS. The binding pocket of PDZ2 appears to have evolved specific dimensions and chemical properties that accommodate the terminal valine residue while excluding other amino acids, particularly charged residues. This structural specificity contributes to the sequential proteolysis mechanism observed in RIP signaling .

Researchers interested in the structural basis of RseP substrate recognition should consider:

  • Conducting site-directed mutagenesis of key residues within the PDZ2 binding groove

  • Performing crystallographic or cryo-EM studies of RseP in complex with substrate peptides

  • Using molecular dynamics simulations to explore the dynamic interactions between PDZ domains and various substrate termini

  • Developing high-throughput assays to screen potential inhibitors that target these specific recognition interfaces

Understanding these structural determinants could potentially lead to the development of strategies to modulate RseP activity in various biological contexts .

What are the challenges in expressing and purifying functional recombinant RseP?

Expressing and purifying functional recombinant RseP presents several significant challenges due to its nature as a multi-pass membrane protein with complex domain organization. One primary difficulty lies in maintaining proper protein folding during heterologous expression. Membrane proteins often misfold or aggregate when overexpressed, particularly in commonly used systems like E. coli.

To overcome these challenges, consider the following methodological approaches:

  • Optimization of expression systems: Test multiple expression hosts including specialized E. coli strains (C41/C43, Lemo21), yeast systems (P. pastoris), or insect cell systems that may better accommodate membrane protein folding.

  • Fusion partners and solubility tags: Incorporate fusion partners that enhance membrane protein expression and folding, such as MBP (maltose-binding protein) or SUMO tags, with engineered protease cleavage sites for tag removal after purification.

  • Detergent screening: Systematically evaluate different detergents and lipid mixtures for extraction and purification, as detergent choice significantly impacts protein stability and activity. Consider newer amphipathic polymers like SMA (styrene-maleic acid) that can extract membrane proteins with their native lipid environment.

  • Activity verification: Implement functional assays at each purification step to track retention of enzymatic activity, as high protein yield does not necessarily correlate with functional protein.

  • Protein stabilization strategies: Explore the addition of specific lipids, ligands, or binding partners that might stabilize RseP during purification.

When designing purification protocols, carefully consider buffer components, particularly the presence of divalent cations that may be essential for metalloproteases like RseP. Temperature control during purification is also critical, as membrane proteins are often more stable at lower temperatures despite potentially slower purification kinetics .

How does RseP activity vary across different bacterial species and what are the evolutionary implications?

RseP homologs exist across diverse bacterial species, displaying varying degrees of sequence conservation and potentially different substrate specificities and regulatory mechanisms. Comparative analysis reveals that while the catalytic domain of RseP is generally well-conserved, the regulatory elements, including the PDZ domains, show greater variability. This suggests evolutionary adaptation to species-specific signaling requirements and stress response pathways.

The evolutionary implications of these variations include:

  • Adaptive responses to different environmental niches and stressors

  • Species-specific integration with other signaling pathways

  • Potential co-evolution with substrate proteins and regulatory partners

  • Divergent mechanisms for controlling protease activity

When studying RseP across species, experimental designs should account for these variations. Heterologous expression systems may not provide the appropriate cellular context for proper function, necessitating species-specific approaches. Additionally, substrate prediction algorithms developed for one species may not accurately identify substrates in distantly related bacteria.

From a methodological perspective, researchers should consider phylogenetic analyses alongside biochemical characterization when investigating RseP evolution. This combined approach can reveal how structural and functional changes correlate with evolutionary distance and ecological adaptation .

What emerging technologies might advance our understanding of RseP function and regulation?

Several cutting-edge technologies show promise for advancing our understanding of RseP function and regulation beyond current methodological limitations:

  • Cryo-electron microscopy (cryo-EM): Recent advances in cryo-EM technology enable structural determination of membrane proteins in near-native environments, potentially revealing how RseP's conformation changes during catalysis and regulation. Time-resolved cryo-EM could potentially capture intermediate states during the proteolytic reaction.

  • HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry): This technique can provide insights into protein dynamics and conformational changes in RseP upon substrate binding or interaction with regulatory factors, complementing static structural information.

  • Single-molecule FRET: Applying this technique to RseP could reveal real-time conformational changes during substrate recognition and cleavage, providing insights into reaction kinetics at the single-molecule level.

  • Nanobody-based approaches: Developing specific nanobodies against different conformational states of RseP could stabilize these states for structural studies or serve as tools to probe RseP function in cellular contexts.

  • Mass spectrometry-based proteomics: Advanced proteomics approaches, including TAILS (Terminal Amine Isotopic Labeling of Substrates) or ATOMS (Amino-Terminal Oriented Mass Spectrometry of Substrates), could identify the full repertoire of RseP substrates in different physiological contexts.

  • Microfluidics-based assays: These systems allow precise control over reaction conditions and real-time monitoring of RseP activity, potentially enabling high-throughput screening of substrates or inhibitors.

When designing experiments utilizing these technologies, careful consideration of controls and validation steps is essential. For example, when identifying new substrates through proteomics, confirmation through complementary biochemical approaches is necessary to distinguish direct RseP substrates from indirect effects. Similarly, structural insights from cryo-EM should be validated through functional studies using site-directed mutagenesis of key residues identified in the structures .

How can I address inconsistent results in RseP activity assays?

Inconsistent results in RseP activity assays often stem from several methodological factors that can be systematically addressed. First, evaluate protein quality and stability, as membrane proteins like RseP are particularly prone to aggregation and denaturation. Implement routine quality control measures including size exclusion chromatography or dynamic light scattering to verify protein homogeneity before each experiment.

Substrate preparation variability can significantly impact results. Standardize substrate production protocols, including consistent expression, purification, and storage conditions. For pre-cleaved substrates mimicking DegS-processed RseA, verify the precision of the N-terminal sequence, as variations at the Val-148 position can dramatically affect RseP recognition and cleavage efficiency .

Buffer composition presents another critical variable. Systematically test the effects of:

  • Detergent type and concentration

  • Ionic strength

  • pH variations

  • Presence of specific metal ions

  • Reducing agents

When analyzing inconsistent data, consider employing statistical approaches that can help identify outliers or patterns in variability. Rather than discarding "failed" experiments, document all conditions systematically to potentially identify hidden variables affecting RseP activity. Implement a standardized protocol for data collection and analysis to minimize experimenter-dependent variations .

What are the best approaches for studying the kinetics of RseP-mediated proteolysis?

Studying the kinetics of RseP-mediated proteolysis requires specialized approaches due to the membrane-embedded nature of the enzyme and its substrates. Traditional solution-phase enzyme kinetics methods must be adapted for the membrane environment.

For rigorous kinetic analysis:

  • Develop real-time assays: Implement FRET-based substrates where fluorophore and quencher are positioned to report on cleavage events in real-time, allowing continuous monitoring of reaction progress.

  • Control substrate presentation: Since RseP functions within membranes, ensure that substrates are properly incorporated into the same membrane environment as the enzyme, maintaining physiologically relevant concentrations and orientations.

  • Account for membrane effects: Lipid composition can significantly affect enzyme kinetics, so systematically vary membrane composition to understand its impact on reaction rates.

  • Apply appropriate kinetic models: Traditional Michaelis-Menten kinetics may not fully describe membrane-embedded protease activity. Consider more complex models that account for the two-dimensional diffusion within membranes and potential substrate clustering effects.

When designing experiments to determine kinetic parameters:

  • Use a wide range of substrate concentrations

  • Collect multiple time points to establish initial reaction velocities

  • Ensure that substrate depletion remains minimal during initial rate measurements

  • Include appropriate controls for spontaneous substrate degradation

Present kinetic data in clear graphical formats that allow readers to evaluate both the raw data and the fitted models. Include residual plots to demonstrate the quality of fits to kinetic models .

What are the critical unanswered questions about RseP structure and function?

Despite significant advances in understanding RseP, several critical questions remain unanswered that represent important directions for future research:

  • Complete structural characterization: While partial structural information about RseP's PDZ domains exists, a complete high-resolution structure of full-length RseP in complex with its substrate would provide unprecedented insights into the catalytic mechanism and substrate recognition.

  • Regulatory mechanisms: How is RseP activity regulated beyond the requirement for Site-1 cleavage? Potential post-translational modifications or interactions with other regulatory proteins remain largely unexplored.

  • Substrate spectrum: Beyond RseA, does RseP process other substrates in vivo? Comprehensive substrate identification could reveal additional cellular pathways involving RseP.

  • Membrane environment effects: How do specific lipids or membrane properties modulate RseP activity and substrate recognition? The relationship between membrane composition and RseP function remains poorly understood.

  • Coordination with other proteases: How is the sequential proteolysis by DegS and RseP coordinated temporally and spatially within the cell? Are these proteases organized into functional complexes?

How might understanding RseP contribute to developing novel antimicrobial strategies?

Understanding RseP's structure, function, and role in bacterial stress responses could potentially lead to novel antimicrobial strategies. As a key component of the σE stress response pathway, RseP helps bacteria adapt to various environmental stresses, including those encountered during infection and exposure to antibiotics. Targeting this pathway could potentially sensitize bacteria to existing antibiotics or environmental stresses.

Several potential therapeutic approaches emerge from RseP research:

  • Direct inhibition: Designing specific inhibitors that target RseP's catalytic site or substrate-binding regions could disrupt stress response pathways, potentially rendering bacteria more vulnerable to host defenses or concurrent antibiotic therapy.

  • Allosteric modulation: Compounds that bind to regulatory domains of RseP could alter its activity or specificity, disrupting normal stress signaling.

  • Substrate mimetics: Developing peptides or peptidomimetics that resemble RseP substrates but resist cleavage could competitively inhibit processing of natural substrates.

  • Combination approaches: Identifying synergistic interactions between RseP inhibition and existing antibiotics could lead to more effective combination therapies, potentially overcoming resistance mechanisms.

When designing experiments to explore these therapeutic possibilities:

  • Implement high-throughput screening approaches to identify potential inhibitors

  • Develop robust cellular assays to verify target engagement and pathway disruption

  • Assess effects on bacterial virulence and antibiotic susceptibility in relevant infection models

  • Consider species-specific differences in RseP structure and function when developing targeted approaches

While targeting stress response pathways presents promising opportunities, careful consideration of potential limitations is essential, including the risk of resistance development and effects on beneficial microbiota .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.