Recombinant Regulatory protein BlaR1 (blaR1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Antibiotic Resistance

BlaR1 regulates resistance through a two-component signaling pathway:

  1. Signal Detection: β-lactam antibiotics acylate the sensor domain, triggering conformational changes.

  2. Signal Transduction: Structural rearrangements propagate through the transmembrane domain to activate the cytoplasmic metalloprotease.

  3. Repressor Degradation: Activated BlaR1 cleaves BlaI, derepressing transcription of blaZ (β-lactamase PC1) and mecA (PBP2a) .

Experimental Evidence

ConditionObservationReference
No β-lactam antibioticsAutolytic cleavage occurs spontaneously (e.g., 36.6 kDa fragment detected)
β-lactam exposure (e.g., CBAP)No change in cleavage rate; acylation does not directly modulate proteolysis
Zinc-deficient environmentProteolytic activity abolished; metal ion dependency confirmed

Recombinant Expression and Autolytic Activity

BlaR1 is often expressed in E. coli using systems like pET-24a(+)_BlaRHis6x (C-terminal His6 tag) . Key findings:

  • Autocatalytic Cleavage: Recombinant BlaR1 undergoes fragmentation between Ser283-Phe284 and Arg293-Arg294, even in the absence of antibiotics .

  • Sensor Domain Shedding: The extracellular sensor domain is cleaved and released into the extracellular medium, proposed as a mechanism for signal termination .

Table: Recombinant BlaR1 Expression Systems

Host OrganismVectorTagKey InsightReference
E. coli BL21pET-24a(+)_BlaRHis6xC-terminal His6xLow expression but sufficient for structural studies
E. coli BL21pET-24a(+)_BlaRHis6xC-terminal His6xAutolytic cleavage confirmed via Western blot

Phosphorylation-Dependent Activation

BlaR1 is phosphorylated at Serine and Tyrosine residues in its cytoplasmic domain upon β-lactam exposure. This modification:

  • Is essential for BlaI degradation and resistance induction.

  • Can be inhibited by synthetic kinase inhibitors, restoring β-lactam susceptibility .

Cross-Talk with mecA Regulation

BlaR1 interacts with MecI (a mecA repressor) through heterodimer formation, reducing MecI’s affinity for the mecA promoter. This cooperation optimizes resistance in MRSA strains .

Clinical and Therapeutic Implications

  • Target for Antimicrobial Strategies: BlaR1’s role as a "master switch" makes it a candidate for disrupting resistance pathways .

  • Fitness Cost Mitigation: The bla locus compensates for the metabolic burden of mecA expression in MRSA, suggesting dual targeting of BlaR1 and MecI could enhance treatment efficacy .

Key Challenges and Limitations

  • Low Native Expression: BlaR1 is expressed at minimal levels in S. aureus, complicating in vivo studies .

  • Complexity of Signal Transduction: Full mechanistic understanding requires further studies on BlaR1 dynamics and interactions with other regulators (e.g., BlaR2) .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly specify your requirement in the order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. For specific delivery times, please consult your local distributors.
As a standard practice, all our proteins are shipped with normal blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
blaR1; penR1; Regulatory protein BlaR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-601
Protein Length
full length protein
Species
Bacillus licheniformis
Target Names
blaR1
Target Protein Sequence
MSSSFFIPFLVSQILLSLFFSIIILIKKLLRTQITVGTHYYISVISLLALIAPFIPFHFL KSHHFDWILNLGGAQSALSQTHSTDKTTEAIGQHVNWVQDFSLSIEQSSSKMIDSAFFAV WILGVAVMLLATLYSNLKIGKIKKNLQIVNNKELLSLFHTCKEEIRFHQKVILSRSPLIK SPITFGVIRPYIILPKDISMFSADEMKCVLLHELYHCKRKDMLINYFLCLLKIVYWFNPL VWYLSKEAKTEMEISCDFAVLKTLDKKLHLKYGEVILKFTSIKQRTSSLLAASEFSSSYK HIKRRIVTVVNFQTASPLLKAKSALVFTLVLGAILAGTPSVSILAMQKETRFLPGTNVEY EDYSTFFDKFSASGGFVLFNSNRKKYTIYNRKESTSRFAPASTYKVFSALLALESGIITK NDSHMTWDGTQYPYKEWNQDQDLFSAMSSSTTWYFQKLDRQIGEDHLRHYLKSIHYGNED FSVPADYWLDGSLQISPLEQVNILKKFYDNEFDFKQSNIETVKDSIRLEESNGRVLSGKT GTSVINGELHAGWFIGYVETADNTFFFAVHIQGEKRAAGSSAAEIALSILDKKGIYPSVS R
Uniprot No.

Target Background

Function
BlaR1 is an integral membrane protein that plays a crucial role in detecting the presence of beta-lactam antibiotics and transmitting this information to the cytoplasm. The activation of BlaR1 involves the acylation of a serine residue within the C-terminal sensor domain upon binding of the beta-lactam antibiotic. This triggers a conformational change, relaying the signal from the cell surface to the cytoplasm. Subsequently, the zinc protease domain is activated, initiating autoproteolysis and cleavage of the transcriptional repressor BlaI. This derepression leads to the expression of antibiotic resistance genes.
Protein Families
Peptidase M56 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does BlaR1 contribute to the induction of beta-lactam resistance at the molecular level?

BlaR1 functions within the bla operon regulatory framework through a precisely orchestrated sequence of molecular events:

  • Detection: The extracellular sensor domain of BlaR1 detects β-lactam antibiotics through direct acylation of its active site

  • Signal transduction: This acylation initiates conformational changes that are transmitted across the membrane

  • Protease activation: The cytoplasmic zinc metalloprotease domain becomes activated

  • Repressor cleavage: The activated protease directly cleaves the BlaI repressor protein between residues Asn101 and Phe102

  • Derepression: Cleaved BlaI can no longer bind to operator sequences in the bla operon

  • Gene expression: This leads to increased expression of BlaI, BlaR1, and critically, β-lactamase (PC1)

The entire process occurs rapidly, within minutes of antibiotic exposure, creating an efficient resistance mechanism. Research has shown that this system is highly sensitive - a single BlaR1 modification by antibiotic is sufficient for the entire bacterial generation , demonstrating remarkable signal amplification through the proteolytic cascade.

What is the significance of BlaR1's domain-swapped dimer formation?

BlaR1 forms an extensive domain-swapped dimer with significant functional implications:

The domain swap involves the cytosolic-facing helix α9 of the zinc metalloprotease domain and helix α10 (the terminal transmembrane helix), creating an extensive interface with approximately 3,165 Ų of buried surface area . This arrangement:

  • Stabilizes the signaling loops within the structure

  • Creates a rigid framework that positions the zinc metalloprotease domains for optimal interaction with the BlaI repressor

  • Enables coordinated conformational changes between the two monomers upon β-lactam binding

  • May facilitate signal amplification through cooperative binding effects

The dimeric arrangement appears to be essential for proper function, as it creates a structural framework that enables efficient signal transduction from the sensor domain to the proteolytic domain. This dimerization represents a structural feature that could potentially be targeted for therapeutic intervention to disrupt resistance mechanisms .

How do researchers express and purify sufficient quantities of active BlaR1 for structural studies?

Obtaining adequate quantities of active BlaR1 has historically been challenging due to its membrane-bound nature and complex structure. Successful approaches include:

  • Expression system selection: The nisin-controlled gene expression system in Lactococcus lactis has proven effective for obtaining functional BlaR1, overcoming limitations seen with other expression hosts .

  • Activity monitoring: Researchers can monitor BlaR1 expression and purification by using covalently bound fluorescent β-lactams such as BOCILLIN FL, which bind specifically to the sensor domain .

  • Autocleavage management: Wild-type BlaR1 undergoes spontaneous autocleavage between residues Ser283 and Phe284. For structural studies requiring intact protein, researchers can use the F284A mutation which mitigates this autocleavage while still maintaining basic functionality .

  • Oligomeric enrichment: Rate-zonal ultracentrifugation techniques can be employed to enrich samples for intact oligomeric BlaR1 species, which is critical for structural studies .

  • Detergent optimization: Careful selection of detergents for solubilization is essential to maintain BlaR1 in its native conformation during purification.

This methodological approach has enabled breakthrough structural studies using cryo-electron microscopy, revealing previously unknown aspects of BlaR1 structure and function .

What is the proposed mechanism for how β-lactam binding to the sensor domain activates the distant metalloprotease domain?

The allosteric signaling mechanism of BlaR1 involves several coordinated molecular events:

  • β-lactam antibiotics bind and acylate the active site in the sensor domain

  • This binding induces exclusion of the prominent extracellular loop (EL1, residues 56-96) that was previously bound competitively in the sensor domain active site

  • The exclusion of this loop triggers a shift in the sensor domain position relative to the membrane

  • This movement propagates through the transmembrane helices, causing conformational changes in the zinc metalloprotease domain

  • These conformational changes enhance the expulsion of autocleaved products from the active site

  • The equilibrium shifts to a state that is permissive of efficient BlaI cleavage

This mechanism represents a sophisticated example of transmembrane signal transduction, where binding events on one side of the membrane directly influence proteolytic activity on the opposite side . The domain-swapped dimer structure appears critical for this signaling process, as it provides the structural framework necessary for coordinated movement between domains.

What experimental techniques are most effective for studying the dynamic aspects of BlaR1 signaling?

Researchers have employed multiple complementary techniques to study BlaR1 dynamics:

TechniqueApplication to BlaR1Key Insights Gained
Cryo-electron microscopyVisualization of different conformational statesRevealed domain-swapped dimer and relative positioning of domains
Site-directed mutagenesisIdentification of critical residuesF284A mutation revealed role of autocleavage in signaling
Fluorescent β-lactam labelingTracking of sensor domain activityEnabled monitoring of BlaR1 expression and purification
Immunoprecipitation with specific antibodiesIsolation of BlaR1 fragmentsCharacterized fragmentation patterns during signal transduction
Protease activity assaysMeasurement of BlaI cleavageDemonstrated direct cleavage of BlaI by BlaR1
Edman N-terminal sequencingIdentification of precise cleavage sitesConfirmed autocleavage site between Ser283-Phe284

Combined approaches that integrate structural analysis with functional assays have proven most effective for understanding the complex dynamics of BlaR1 signaling. Time-course experiments are particularly valuable for tracking the progression of conformational changes following β-lactam exposure .

What is the relationship between BlaR1 autocleavage and its ability to cleave the BlaI repressor?

The relationship between BlaR1 autocleavage and BlaI cleavage reveals a nuanced regulatory mechanism:

  • Autocleavage-deficient BlaR1(F284A) mutants retain some ability to cleave BlaI, albeit at reduced levels compared to wild-type BlaR1

  • This indicates autocleavage is not an absolute requirement for BlaI cleavage but rather enhances the efficiency of the response

  • The autocleavage appears to be spontaneous and not strictly part of the signal transduction mechanism itself

  • The enhanced efficiency provided by autocleavage may be necessary for resistance in vivo, where rapid response to antibiotics is critical

What is the evidence that BlaR1 directly cleaves BlaI without requiring additional cellular components?

Previous research had suggested that additional components might be necessary for BlaI cleavage, but recent evidence strongly supports direct cleavage by BlaR1:

  • Purified recombinant BlaR1 variants (including wild-type and BlaR1(USA300)) directly cleave purified BlaI in vitro

  • This cleavage activity is:

    • Completely inhibited by EDTA (metalloprotease inhibitor)

    • Not affected by serine/cysteine protease inhibitors

    • Specific to the site between BlaI residues Asn101 and Phe102, as confirmed by Edman N-terminal sequencing

  • BlaR1-containing membranes from Staphylococcus aureus show the same cleavage pattern as purified recombinant BlaR1

  • Structural analysis reveals that the zinc metalloprotease domain of BlaR1 is positioned to allow direct access to BlaI from the cytoplasmic side

These findings collectively demonstrate that BlaR1 functions as a two-component signaling receptor that can directly cleave the repressor without intermediaries, simplifying our understanding of this resistance mechanism .

How does BlaR1 undergo turnover to allow recovery from induction of resistance?

BlaR1 undergoes specific fragmentation patterns that appear to regulate its activity and enable recovery from induced resistance:

The protein experiences fragmentation at two specific sites:

  • A cytoplasmic site (the autocleavage site between Ser283 and Phe284)

  • A site in the sensor domain that leads to "shedding" of the domain into the medium from the surface of the membrane

These fragmentation events have been observed to occur within the relevant timeframe for manifestation of resistance. Importantly, this fragmentation occurs even in Staphylococcus aureus not exposed to β-lactam antibiotics, suggesting the protein is predisposed to degradation within a set period .

This controlled turnover mechanism appears to be evolutionarily designed to:

  • Limit the duration of the resistance response

  • Enable recovery from induction when the antibiotic challenge is removed

  • Prevent unnecessary metabolic burden of continuous resistance protein expression

  • Allow fine-tuning of the resistance response based on environmental conditions

This represents a sophisticated regulatory mechanism that balances the need for antibiotic resistance with the costs associated with maintaining that resistance.

What techniques are most effective for studying BlaR1 protein expression levels and turnover kinetics?

Multiple complementary techniques have proven valuable for investigating BlaR1 expression and turnover:

TechniqueApplicationAdvantages
Immunoaffinity purificationIsolation of full-length BlaR1 and fragmentsCan capture low-abundance fragments
Immunoblot analysisDetection of specific BlaR1 speciesHigh sensitivity for low-copy proteins
Fluorescent β-lactam labelingMonitoring of functional sensor domainDirect assessment of binding capability
Time-course experimentsTracking protein dynamics over timeReveals progression of events after induction
Mass spectrometryIdentification of fragmentation productsPrecise determination of cleavage sites
Pulse-chase labelingMeasurement of protein turnover ratesQuantitative assessment of degradation kinetics

These approaches are particularly important because BlaR1 is expressed at very low copy numbers in Staphylococcus aureus, making detection challenging. Specialized immunoaffinity purification techniques using anti-BlaR antibodies have been critical for isolating and characterizing BlaR1 fragments from both cell extracts and culture media .

How can site-directed mutagenesis be used to investigate critical residues in BlaR1 function?

Site-directed mutagenesis provides powerful insights into BlaR1 structure-function relationships:

Key targets for mutagenesis studies:

  • Catalytic residues in the metalloprotease domain:

    • The H201EXXH and E242XXXD gluzincin signature motifs are critical for zinc coordination and catalysis

    • Mutation of these residues can separate protease activity from sensor function

  • Autocleavage site (Ser283-Phe284):

    • The F284A mutation prevents autocleavage while maintaining basic function

    • This allows investigation of the specific role of autocleavage in signal transduction

  • Sensor domain active site:

    • The sensor domain shares structural similarity with class D serine β-lactamases

    • Mutations in the β-lactam binding pocket can alter specificity for different antibiotics

  • Transmembrane helices:

    • Mutations in transmembrane regions can probe the mechanism of signal transduction across the membrane

    • Particularly important are residues at the interfaces between transmembrane helices

  • Dimerization interface:

    • Mutations disrupting the domain-swapped dimer can reveal its importance in BlaR1 function

    • The extensive interface (approximately 3,165 Ų) provides multiple targets

Successful mutagenesis studies combine structural information with functional assays to connect specific residues to discrete steps in the signaling pathway .

What are the most promising approaches for developing inhibitors targeting BlaR1 to combat antibiotic resistance?

Several strategic approaches show promise for targeting BlaR1 as an antibiotic resistance intervention:

  • Sensor domain competitive inhibitors:

    • Compounds that bind the sensor domain without triggering the conformational changes required for signaling

    • These would prevent BlaR1 from detecting β-lactam antibiotics, maintaining repression of resistance genes

  • Dimerization interface disruptors:

    • Small molecules that prevent or destabilize the domain-swapped dimer formation

    • Since the dimer appears critical for proper signaling, this could disable the resistance mechanism

  • Allosteric modulators:

    • Compounds binding to regions outside the active sites that lock BlaR1 in an inactive conformation

    • These could prevent signal transduction across the membrane

  • Metalloprotease domain inhibitors:

    • Selective zinc metalloprotease inhibitors that prevent BlaI cleavage

    • These would maintain repression of resistance genes even when β-lactams are present

  • EL1 loop modulators:

    • Molecules that stabilize the extracellular loop (EL1) in the sensor domain active site

    • This could prevent the conformational changes that trigger signaling

The structural insights from recent cryo-electron microscopy studies provide a molecular foundation for these therapeutic approaches, potentially leading to novel adjuvants that could restore sensitivity to β-lactam antibiotics in resistant Staphylococcus aureus strains, including MRSA .

How does BlaR1 compare structurally and functionally with the related protein MecR1?

BlaR1 and MecR1 share significant similarities while maintaining distinct roles in antibiotic resistance:

FeatureBlaR1MecR1
Resistance mediationControls β-lactamase (blaZ) expressionPrimarily regulates mecA (PBP2a) expression
Sensor domain structureClass D serine β-lactamase foldNearly identical to BlaR1 (Cα RMSD ~2.9 Å)
AutocleavageOccurs between Ser283-Phe284Similar autocleavage observed
Repressor targetBlaIMecI (and can cross-talk with BlaI)
Clinical significancePresent in many resistant S. aureus strainsDefining feature of MRSA
Antibiotics sensedBroad range of β-lactamsSimilar spectrum to BlaR1

Both proteins operate through homologous two-component signaling mechanisms, with the β-lactam sensor domain detecting antibiotics and the metalloprotease domain cleaving their respective repressors. The high degree of structural similarity in their sensor domains (RMSD ~2.9 Å) suggests that inhibitor development targeting one protein might affect both systems, potentially providing a broader strategy against resistance mechanisms .

How might research on BlaR1 inform our understanding of similar antibiotic resistance mechanisms in other pathogens?

The BlaR1 signaling pathway represents a model system with broad implications:

  • Mechanistic insights for homologous systems:

    • Similar two-component signaling receptors exist in other pathogens including Mycobacterium tuberculosis and Clostridioides difficile

    • The structural and functional principles revealed in BlaR1 may apply to these systems

  • Transmembrane signal transduction:

    • BlaR1 demonstrates how environmental sensing can be coupled to gene regulation across a membrane barrier

    • This principle extends beyond antibiotic resistance to various bacterial adaptation mechanisms

  • Resistance regulation dynamics:

    • The controlled turnover of BlaR1 through specific fragmentation reveals sophisticated temporal control

    • Similar regulatory mechanisms may operate in other resistance systems to balance resistance with fitness costs

  • Therapeutic strategy development:

    • Approaches targeting BlaR1 could serve as a template for interventions against other resistance mechanisms

    • The concept of disabling resistance rather than directly killing bacteria represents an alternative strategy to combat antimicrobial resistance

  • Evolutionary considerations:

    • The domain-swapped structure and unusual topology of BlaR1 provide insights into how complex regulatory systems evolve

    • This has implications for understanding the emergence and spread of resistance mechanisms

The increasing structural and functional data on BlaR1 thus provides a valuable framework for investigating and potentially targeting similar resistance mechanisms across diverse bacterial pathogens .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.