Recombinant Reithrodon auritus NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Functional Role in Complex I

As part of the 41-subunit mammalian Complex I, MT-ND3 contributes to:

FunctionMechanistic InsightSupporting Evidence
Proton translocationBinds to quinone intermediates, enabling conformational changes for H⁺ pumping Kinetic modeling , mutational studies
Electron transferFacilitates electron flow from Fe-S clusters to ubiquinone via hydrophobic interactionsStructural homology
Enzyme assemblyEssential for stabilizing the membrane arm; absence prevents Complex I formation RNAi suppression experiments

Studies on homologous ND3 subunits in other species reveal that mutations disrupt proton coupling efficiency by 40–60% , underscoring its conservation across eukaryotes.

Recombinant Production and Applications

Commercial sources (e.g., MyBioSource) provide this protein as a research tool with the following specifications :

ParameterDetail
Expression systemE. coli or mammalian cells (unspecified in public data)
Purity>90% by SDS-PAGE
StorageTris-based buffer with 50% glycerol; stable at -20°C or -80°C
ApplicationsEnzyme kinetics, antibody production, mitochondrial disorder studies

Pricing ranges from $1,385 (MyBioSource) to €1,456 (LabM) , reflecting its niche research utility.

Research Limitations and Gaps

  • Species-specific data: No peer-reviewed studies directly investigating Reithrodon auritus MT-ND3 exist; functional insights are extrapolated from human, bovine, and algal homologs .

  • Mechanistic ambiguity: The exact role of ND3 in proton translocation remains unresolved due to challenges in isolating membrane-bound subunits .

  • Clinical relevance: While human ND3 mutations link to Leigh syndrome and cardiomyopathy , no disease associations are reported for Reithrodon auritus ND3.

Future Directions

  • Cryo-EM studies: To resolve conformational changes during quinone reduction .

  • Cross-species comparisons: Evaluate evolutionary adaptations in ND3 among rodents.

  • Therapeutic screening: Use recombinant ND3 to test Complex I inhibitors for metabolic diseases .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference in the order remarks. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Reithrodon auritus (Bunny rat)
Target Names
Target Protein Sequence
MNMMLAMLINITLSLCLISLAFWLPQLNLYSEKASPYECGFDPMSSARLPFSMKFFLVGI TFLLLDLEIALLLPLPWAIQSTNMITTTIVSLSLVSILALGLSYEWMNKGLEWTE
Uniprot No.

Target Background

Function
As a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), this protein plays a crucial role in catalyzing electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Its presence is essential for the catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its role in cellular respiration?

MT-ND3 is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is encoded by mitochondrial DNA and is considered part of the minimal assembly required for catalytic activity. The primary function of MT-ND3 involves the transfer of electrons from NADH to the respiratory chain, with ubiquinone serving as the immediate electron acceptor for the enzyme .

To investigate this function, researchers typically employ respirometry techniques to measure oxygen consumption rates in isolated mitochondria or intact cells. The most effective approach involves comparing wild-type cells with those containing mutated or depleted MT-ND3, allowing for direct assessment of its contribution to complex I activity. Additionally, blue native polyacrylamide gel electrophoresis (BN-PAGE) followed by in-gel activity assays can visualize complex I assembly and function.

How do mutations in MT-ND3 contribute to mitochondrial diseases?

Mutations in MT-ND3 have been linked to several mitochondrial disorders, most notably Leigh syndrome caused by the T10158C mutation in mtDNA. This mutation disrupts the formation of functional complexes in the mitochondrial respiratory chain, leading to impaired energy production . Additionally, specific single nucleotide polymorphisms (SNPs) in MTND3 have been associated with various conditions, including:

SNPAssociated ConditionFunctional Impact
rs2853826Type 2 diabetes mellitusIncreased ROS production
rs28358278Gastric cancerIncreased susceptibility
rs41467651Gastric cancerIncreased susceptibility

To study these mutations, researchers employ techniques such as ARMS-PCR (Amplification Refractory Mutation System-PCR) for quantitative determination of mutation rates . This method involves designing primers that specifically detect either wild-type or mutant sequences, allowing for precise measurement of heteroplasmy levels in mitochondrial populations.

What experimental models are most appropriate for studying Reithrodon auritus MT-ND3?

When investigating Reithrodon auritus MT-ND3, researchers must consider several experimental approaches based on their specific research questions. Cell-based models often provide the most accessible system, with options including:

  • Heterologous expression in established cell lines (HEK293, COS-7) to study basic protein properties

  • Patient-derived fibroblasts for disease modeling, particularly when comparing with healthy controls

  • Cybrid cell lines, which combine enucleated cells containing Reithrodon auritus mitochondria with human nuclear backgrounds

For protein expression and purification, multiple systems have been employed successfully, including in vitro E. coli expression systems, which are commonly used for producing recombinant MT-ND3 proteins . The selection of an appropriate expression system depends on downstream applications and whether post-translational modifications are critical for the research question.

What are the challenges in expressing and purifying functional recombinant MT-ND3?

Expressing and purifying functional MT-ND3 presents several significant challenges due to its hydrophobic nature and integration within the inner mitochondrial membrane. Researchers have employed various expression systems including E. coli, yeast, baculovirus, and mammalian cells , each with distinct advantages and limitations.

  • Using specialized E. coli strains designed for membrane protein expression

  • Expressing the protein as a fusion with solubility-enhancing tags (MBP, SUMO, Trx)

  • Optimizing induction conditions (temperature, IPTG concentration, induction time)

  • Selecting appropriate detergents for extraction and purification (DDM, LMNG, or digitonin)

  • Incorporating stabilizing agents in purification buffers

The purification strategy typically involves immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography to obtain homogeneous protein preparations. Western blotting with specific antibodies against MT-ND3 can confirm protein identity and purity .

How can researchers effectively deliver therapeutic mRNA encoding MT-ND3 to mitochondria?

Delivering therapeutic mRNA encoding wild-type MT-ND3 to mitochondria represents a promising approach for treating mitochondrial diseases caused by mutations in this gene. The MITO-Porter system has demonstrated effectiveness in this application . This methodology involves:

  • Designing optimized therapeutic mRNA:

    • Converting the non-canonical start codon (ATA) to ATG

    • Adding polyA modifications to enhance translation

    • Modifying termination codons for improved recognition

  • Preparing delivery vehicles:

    • Formation of RNA nanoparticles with polycations at specific nitrogen/phosphate (N/P) ratios

    • Encapsulation in MITO-Porter liposomes modified with R8 peptides

    • Optimization of particle size (approximately 145 nm) and surface charge (-35 mV)

  • Validating mitochondrial delivery:

    • Tracking cellular uptake using fluorescently labeled MITO-Porter

    • Confirming mitochondrial localization via confocal microscopy

    • Isolating mitochondria and performing RNase treatment to remove RNA bound to the outer membrane

  • Assessing therapeutic efficacy:

    • Quantifying reduction in mutant mRNA levels using reverse transcription followed by ARMS-qPCR

    • Measuring improvements in mitochondrial respiratory function through respirometry

This approach has successfully reduced mutant mRNA levels and improved maximal mitochondrial respiratory activity in patient-derived fibroblasts with the T10158C mutation .

What techniques are most effective for studying MT-ND3 interactions with other complex I components?

Understanding how MT-ND3 interacts with other components of complex I is crucial for elucidating its role in complex assembly and function. Several sophisticated techniques can be employed:

  • Chemical crosslinking coupled with mass spectrometry (XL-MS):

    • Captures transient interactions through covalent bonds

    • Identifies interaction interfaces with amino acid-level resolution

    • Compatible with membrane protein complexes when appropriate crosslinkers are selected

  • Cryo-electron microscopy (Cryo-EM):

    • Provides high-resolution structural information without crystallization

    • Can resolve the position of MT-ND3 within the intact complex I

    • Enables visualization of conformational changes during the catalytic cycle

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps protein interaction surfaces by measuring changes in hydrogen-deuterium exchange rates

    • Identifies regions protected or exposed during complex assembly

    • Works with membrane proteins when combined with appropriate detergent systems

  • Genetic approaches:

    • Site-directed mutagenesis of specific residues to disrupt interactions

    • Suppressor mutation analysis to identify compensatory changes

    • Deletion analysis to determine essential interaction domains

When applying these techniques to MT-ND3, researchers must carefully consider the protein's hydrophobic nature and mitochondrial localization. Sample preparation typically requires gentle solubilization with digitonin or other mild detergents to maintain native interactions within the complex.

How can MT-ND3 polymorphisms serve as biomarkers for disease susceptibility?

MT-ND3 polymorphisms have significant potential as biomarkers for disease susceptibility and progression. Research has established associations between specific SNPs in MTND3 and increased risk for several conditions, particularly gastric cancer . A case-control study identified five SNPs in MTND3 (rs28358278, rs2853826, rs201397417, rs41467651, and rs28358275) with potential clinical significance .

The rs2853826 polymorphism specifically has been linked to multiple conditions:

  • Increased ROS production in type 2 diabetes mellitus

  • Parkinson's disease susceptibility

  • Breast and esophageal cancer risk

To validate and implement these biomarkers in clinical settings, researchers should:

  • Conduct large-scale population studies across diverse ethnic backgrounds

  • Employ high-throughput genotyping methods like Sanger sequencing or SNP arrays

  • Correlate genotypes with clinical outcomes through prospective cohort studies

  • Develop standardized PCR-based assays for routine clinical testing

The methodological approach used in gastric cancer studies provides a model, involving PCR amplification of the target region followed by sequencing with the BigDye Terminator v3.1 Cycle Sequencing Kit on an ABI PRISM 3730XL system .

What insights can comparative analysis of MT-ND3 across species provide?

Comparative analysis of MT-ND3 across species offers valuable insights into evolutionary conservation, functional constraints, and species-specific adaptations. The availability of recombinant MT-ND3 from diverse organisms including Reithrodon auritus (Bunny rat) , Xenopus laevis (African clawed frog), and Lycodon semicarinatus (Ryukyu odd-tooth snake) facilitates such comparative studies.

A comprehensive comparative analysis would typically involve:

  • Multiple sequence alignment: Identifying conserved residues that likely serve critical functional roles across species

  • Phylogenetic analysis: Reconstructing evolutionary relationships based on MT-ND3 sequences

  • Selection pressure analysis: Calculating dN/dS ratios to identify regions under positive or purifying selection

  • Structural comparison: Using homology modeling to predict and compare protein structures across species

These approaches can reveal:

  • Core functional domains essential for electron transport

  • Regions that have undergone adaptive evolution in specific lineages

  • Correlations between sequence variations and metabolic adaptations

  • Potential therapeutic targets based on conserved functional sites

Researchers can leverage commercially available recombinant proteins from different species to experimentally test hypotheses generated through comparative analysis, such as functional differences in catalytic activity, stability, or interaction with other complex I components.

How might engineered variants of MT-ND3 be used for therapeutic applications?

Engineered variants of MT-ND3 represent a promising frontier for therapeutic interventions in mitochondrial diseases. Based on current research approaches, several strategies merit exploration:

  • Gene therapy with optimized MT-ND3 constructs:

    • Developing mitochondrially-targeted mRNA with enhanced stability and translation efficiency

    • Creating variants resistant to mitochondrial RNases

    • Engineering constructs with improved incorporation into complex I

  • Allotopic expression strategies:

    • Designing nuclear-encoded versions of MT-ND3 with mitochondrial targeting sequences

    • Optimizing codon usage for cytosolic translation

    • Incorporating features to facilitate import and assembly into complex I

  • mRNA therapy approaches:

    • Building on the MITO-Porter system demonstrated in Leigh syndrome fibroblasts

    • Developing improved delivery vehicles with enhanced mitochondrial targeting

    • Optimizing mRNA stability through chemical modifications

  • Protein replacement therapy:

    • Utilizing cell-penetrating peptides to deliver recombinant MT-ND3 protein

    • Engineering hybrid fusion proteins that can traverse mitochondrial membranes

    • Developing nanoparticle formulations for improved bioavailability

When evaluating these therapeutic approaches, researchers should assess:

  • Efficiency of mitochondrial targeting

  • Functional integration into complex I

  • Restoration of electron transport chain activity

  • Reduction in ROS production

  • Improvement in cellular ATP levels

  • Safety profile and potential immunogenicity

The successful mRNA delivery approach using the MITO-Porter system provides a proof-of-concept that could be expanded to various MT-ND3-related mitochondrial disorders.

What quality control measures are essential when working with recombinant MT-ND3?

Ensuring the quality of recombinant MT-ND3 is crucial for obtaining reliable experimental results. Comprehensive quality control should include:

  • Protein integrity verification:

    • SDS-PAGE analysis to confirm molecular weight

    • Western blotting with specific antibodies (such as those available for human MT-ND3)

    • Mass spectrometry to verify protein sequence and identify potential modifications

  • Purity assessment:

    • Size exclusion chromatography to evaluate homogeneity

    • Dynamic light scattering to detect aggregation

    • Analytical ultracentrifugation for detailed analysis of oligomeric state

  • Functional validation:

    • NADH:ubiquinone oxidoreductase activity assays

    • Integration into complex I using reconstitution experiments

    • Electron transport capacity in liposome systems

  • Structural integrity:

    • Circular dichroism spectroscopy to assess secondary structure

    • Thermal shift assays to evaluate stability

    • Limited proteolysis to probe for properly folded domains

  • Storage stability monitoring:

    • Accelerated stability tests under various conditions

    • Activity retention after freeze-thaw cycles

    • Long-term storage protocols validation

Commercial recombinant MT-ND3 proteins are typically supplied in optimized storage buffers containing 50% glycerol and are recommended to be stored at -20°C or -80°C for extended preservation . Researchers should validate each batch of recombinant protein before use in critical experiments to ensure consistency of results.

How can researchers accurately quantify MT-ND3 mutation rates in heteroplasmic samples?

Accurate quantification of MT-ND3 mutation rates in heteroplasmic samples is essential for studies of mitochondrial diseases and therapeutic interventions. The Amplification Refractory Mutation System-quantitative PCR (ARMS-qPCR) has been established as an effective method for this purpose .

The ARMS-qPCR procedure involves:

  • Sample preparation:

    • Isolation of intact mitochondria from cells

    • RNase treatment to remove RNA absorbed on the mitochondrial surface

    • Extraction of mitochondrial RNA using specialized kits

    • Reverse transcription to generate cDNA

  • Primer design:

    • Common forward primer binding to a conserved region

    • Two reverse primers: one specific to wild-type sequence, one to mutant sequence

    • Introduction of mismatches at the 3' terminal to enhance specificity

    • Validation using known mixtures of wild-type and mutant templates

  • Quantitative analysis:

    • Parallel qPCR reactions with wild-type and mutant-specific primers

    • Calculation of mutation rate using the formula:
      Mutation rate (%) = [Amount of mutant/(Amount of wild-type + Amount of mutant)] × 100

    • Generation of standard curves using defined mixtures of mutant and wild-type templates

This approach can detect mutation rates across the entire range (0-100%) with high accuracy and has been successfully applied to evaluate the effectiveness of mRNA therapy in reducing the proportion of mutant MT-ND3 in patient-derived fibroblasts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.