Recombinant Reithrodontomys megalotis NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference when placing your order. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Reithrodontomys megalotis (Western harvest mouse)
Target Names
Target Protein Sequence
MNMFIVLLVNISLASCLILIAFWLPQLNIYTEKANPYECGFDPMSSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWAIQMSNIKATMLTSFILVSVLAMGLAYEWLQKGLEWTE
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor. This subunit is essential for the catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its functional role in mitochondria?

The protein plays a crucial role in the active/inactive transition of complex I, a regulatory mechanism that protects against excessive reactive oxygen species production during respiratory stress. Disruption of this transition through mutations has been linked to several mitochondrial diseases in humans, suggesting evolutionary conservation of this critical function .

How can researchers effectively deliver MT-ND3 mRNA to mitochondria for therapeutic applications?

Mitochondrial delivery of functional MT-ND3 mRNA presents significant challenges but holds promise for treating mitochondrial diseases. An effective methodology involves using a MITO-Porter delivery system, which has been successfully employed to transport therapeutic wild-type ND3 mRNA into mitochondria of cells harboring MT-ND3 mutations .

The process requires designing optimized mRNA constructs with the following critical considerations:

  • Modification of the start codon from native ATA to ATG to enhance translation efficiency (this was specifically done for therapeutic ND3 mRNA delivery)

  • Addition of polyA tails to stabilize the exogenous mRNA

  • Packaging within mitochondria-targeting delivery vehicles

The effectiveness of this approach can be verified through a sequential process:

  • Cell surface washing with CellScrub buffer to remove non-internalized delivery vehicles

  • Mitochondrial isolation followed by RNase treatment to eliminate RNA adhered to the outer mitochondrial membrane

  • RNA extraction from purified mitochondria

  • Reverse transcription to generate cDNA

  • Quantitative analysis using ARMS-PCR to determine mutation rates

This methodology offers a promising avenue for mitochondrial RNA therapeutic interventions, though researchers should carefully optimize delivery conditions for specific cell types and mitochondrial targets.

What techniques are available for quantifying MT-ND3 mutations in experimental models?

The gold standard for quantifying MT-ND3 mutations is Amplification Refractory Mutation System PCR (ARMS-PCR), which enables precise measurement of mutation rates in heteroplasmic mitochondrial DNA populations. This technique employs allele-specific primers designed to discriminate between wild-type and mutant sequences based on specificity at the 3' terminus .

For MT-ND3 mutation analysis, the following methodology has been validated:

  • Design of primer sets:

    • Common forward primer binding to a conserved region

    • Wild-type-specific reverse primer with terminal mismatch to mutant sequence

    • Mutant-specific reverse primer with terminal mismatch to wild-type sequence

  • Optimization of PCR conditions to ensure specificity

  • Quantification using the formula:
    Mutation rate (%) = [MT-primer PCR product] / ([WT-primer PCR product] + [MT-primer PCR product]) × 100

This approach allows for detection of point mutations such as T10158C in mtDNA with high sensitivity. For standard curve generation, researchers should mix defined ratios (0-100%) of plasmids containing wild-type and mutant sequences to validate quantification accuracy .

Alternative approaches include next-generation sequencing for comprehensive mutation profiling and digital droplet PCR for absolute quantification, though ARMS-PCR offers an accessible and cost-effective method with excellent sensitivity for targeted mutation analysis.

What are the optimal storage and handling conditions for recombinant MT-ND3 protein?

For maintaining the structural integrity and biological activity of recombinant Reithrodontomys megalotis MT-ND3 protein, researchers should adhere to the following storage and handling protocols:

  • Short-term storage (up to one week): Maintain working aliquots at 4°C in appropriate buffer

  • Medium-term storage: Store at -20°C in buffer containing 50% glycerol

  • Long-term storage: Preserve at -80°C in Tris-based buffer optimized for protein stability

Critical handling considerations include:

  • Avoiding repeated freeze-thaw cycles, which can lead to protein denaturation and activity loss

  • Using small working aliquots to minimize the need for repeated thawing

  • Maintaining protein in its optimal buffer (typically Tris-based with 50% glycerol)

When transitioning from storage to experimental use, allow samples to equilibrate to room temperature gradually. For applications requiring higher purity or specific buffer conditions, consider buffer exchange using dialysis or size exclusion chromatography while maintaining conditions that preserve the hydrophobic nature of this membrane protein.

How do mutations in MT-ND3 contribute to mitochondrial diseases?

Mutations in MT-ND3 have been implicated in several severe mitochondrial disorders, with distinct pathogenic mechanisms. The relationship between specific mutations and disease phenotypes involves complex interactions with other mitochondrial and nuclear genes .

Key disease associations include:

MT-ND3 MutationAssociated DiseasePathogenic MechanismReference
m.10158T>CMELAS syndromeDisrupts active/inactive transition of complex I
Various point mutationsLeigh syndromeInhibits complex I assembly and function
MT-ND3 mutationsLHON (Leber Hereditary Optic Neuropathy)Impairs electron transport

The pathogenesis involves several mechanisms:

  • Disruption of the active/inactive transition of complex I, leading to increased ROS production

  • Impaired proton translocation across the inner mitochondrial membrane

  • Reduced ATP synthesis capacity

  • Defective complex I assembly and stability

These molecular perturbations manifest as tissue-specific symptoms, particularly in tissues with high energy demands such as brain, muscle, and retina. The variable presentation of symptoms despite identical mutations suggests the influence of additional genetic and environmental factors on disease expression.

How can studies of MT-ND3 in Reithrodontomys megalotis inform therapeutic approaches for human mitochondrial disorders?

Reithrodontomys megalotis MT-ND3 studies provide valuable insights for therapeutic development due to functional conservation between rodent and human mitochondrial proteins. Cross-species analysis offers several advantages for translational research:

  • Evolutionary conservation analysis: MT-ND3 sequences from R. megalotis can be compared with human sequences to identify highly conserved regions that are likely critical for function and potential therapeutic targets.

  • Therapeutic RNA delivery validation: The validated methodologies for delivering wild-type MT-ND3 mRNA to mitochondria in cell models can be adapted for human applications. The MITO-Porter delivery system demonstrated in experimental settings provides a framework for developing human mitochondrial therapies .

  • Mutation-specific intervention strategies: Understanding the molecular consequences of specific mutations in rodent models can inform precision medicine approaches for human patients with corresponding mutations.

  • Biomarker discovery: Comparative studies between species can reveal conserved molecular signatures of mitochondrial dysfunction that may serve as biomarkers for disease progression or therapeutic response.

The adaptation of therapeutic strategies from rodent to human applications requires careful consideration of species-specific differences in mitochondrial import mechanisms, RNA processing, and protein interactions, but the fundamental principles established in R. megalotis studies provide valuable proof-of-concept for human applications .

What approaches can detect heteroplasmy in MT-ND3 mutations with high sensitivity and accuracy?

Detecting heteroplasmy (the coexistence of wild-type and mutant mtDNA) in MT-ND3 mutations requires specialized techniques that offer both sensitivity and quantitative accuracy. Current state-of-the-art approaches include:

  • ARMS-PCR: This technique has been specifically validated for MT-ND3 mutation analysis with excellent sensitivity. The methodology employs:

    • Allele-specific primers designed with terminal nucleotides that match either wild-type or mutant sequences

    • Optimized PCR conditions to ensure specificity

    • Quantification based on relative amplification efficiency

    This approach has been shown to reliably detect heteroplasmy levels across the full range (0-100%) with high correlation between expected and measured values (R² > 0.95) .

  • Digital PCR systems: These platforms offer absolute quantification without the need for standard curves by partitioning the reaction into thousands of individual reactions, enabling single-molecule detection.

  • Next-generation sequencing: Deep sequencing approaches can detect low-level heteroplasmy (down to 1-2%) while simultaneously identifying novel or secondary mutations.

The choice of method depends on research objectives, with ARMS-PCR offering an accessible and validated approach specifically for known MT-ND3 mutations, while more comprehensive technologies like NGS provide broader mutational profiling capabilities.

How does MT-ND3 interact with other complex I components, and what are the functional consequences of these interactions?

MT-ND3 occupies a strategic position within mitochondrial complex I, forming critical interfaces with multiple subunits that influence electron transport and proton pumping efficiency. Key interactions include:

  • Interface with core subunits: MT-ND3 interacts directly with several core subunits including MT-ND1, MT-ND4L, and MT-ND6, forming a functional module that contributes to proton translocation.

  • Conformational gating: The protein participates in the active/inactive transition of complex I through conformational changes that affect the positioning of the ubiquinone binding site. Mutations that disrupt this transition (such as those identified in MT-ND3) can lead to abnormal complex I activity and increased ROS production .

  • Assembly checkpoint: MT-ND3 serves as a critical assembly checkpoint during complex I biogenesis, with its incorporation representing a key step in the assembly pathway.

These interactions have significant functional consequences:

  • Mutations in interface regions can destabilize the entire complex

  • Perturbations in the active/inactive transition can impair the regulatory mechanism that protects against excessive ROS production

  • Disruption of assembly leads to complex I deficiency and compromised OXPHOS

Understanding these interactions provides insight into why specific mutations in this relatively small protein can have profound effects on mitochondrial function and contribute to various disease phenotypes .

What strategies can be employed to develop tissue-specific MT-ND3 therapeutic approaches?

Developing tissue-specific therapies for MT-ND3-related disorders requires overcoming multiple biological barriers while delivering therapeutic agents to the most affected tissues. Several promising strategies include:

  • Engineered delivery vehicles with tissue-targeting ligands:

    • Modification of MITO-Porter or similar delivery systems with tissue-specific targeting peptides

    • Incorporation of ligands that recognize receptors preferentially expressed on target tissues

    • Design of nanoparticles with physical properties that promote accumulation in specific tissues

  • Tissue-specific expression systems:

    • Development of nuclear-encoded MT-ND3 constructs with tissue-specific promoters

    • Engineering of allotopic expression systems that direct the protein to mitochondria

    • Selection of delivery vectors with natural tropism for target tissues (e.g., selected AAV serotypes)

  • Exploiting tissue-specific mitochondrial characteristics:

    • Design of therapeutic approaches that target unique aspects of mitochondria in specific tissues

    • Leveraging differences in mitochondrial membrane potential between tissues

    • Utilizing tissue-specific mitochondrial import machinery variations

The MITO-Porter system demonstrated for MT-ND3 mRNA delivery represents a promising platform that could be further modified for tissue specificity. This approach has shown efficacy in cellular models and could potentially be adapted for targeted delivery to tissues most affected in MT-ND3-related disorders, such as neural tissue in Leigh syndrome or retinal cells in LHON .

How might CRISPR-based approaches be applied to MT-ND3 mutation correction?

CRISPR-based technologies for mitochondrial genome editing represent a frontier in MT-ND3 mutation correction research. While mitochondrial DNA editing has traditionally been challenging due to limitations in delivering CRISPR components to mitochondria, recent advances offer promising directions:

  • DdCBE (DddA-derived cytosine base editors) systems:

    • These engineered base editors can target mitochondrial DNA without requiring double-strand breaks

    • Potential application for precise correction of point mutations in MT-ND3, such as the T10158C mutation associated with MELAS

    • Requires optimization for mitochondrial delivery and specificity

  • RNA editing approaches:

    • Rather than editing mtDNA directly, targeting MT-ND3 mRNA for correction

    • Delivery of engineered deaminases fused to RNA-binding domains

    • Potential for transient correction without permanent alteration of mitochondrial genome

These approaches could theoretically address specific point mutations such as the m.10158T>C mutation in MT-ND3 linked to MELAS syndrome . The development of effective delivery systems for mitochondrial targeting remains a key challenge, but the MITO-Porter system demonstrated for mRNA delivery provides a potential platform that could be adapted for CRISPR component delivery .

What comparative insights can be gained from studying MT-ND3 across different Reithrodontomys species?

Comparative studies of MT-ND3 across Reithrodontomys species can provide valuable evolutionary insights and illuminate structure-function relationships relevant to both basic biology and disease research. Such studies can reveal:

  • Evolutionary conservation patterns:

    • Identification of invariant residues across species that likely represent functionally critical sites

    • Detection of species-specific adaptations that may correlate with metabolic demands or environmental factors

    • Mapping of selection pressures on different protein domains

  • Structure-function correlations:

    • Correlation between sequence variations and species-specific functional characteristics

    • Identification of co-evolving residues that maintain structural integrity or functional interactions

    • Insights into regions tolerant of variation versus those under strict evolutionary constraint

The extensive genetic analyses of Reithrodontomys species (including R. megalotis, R. mexicanus, R. sumichrasti, and R. gracilis) provide an excellent framework for such comparative studies . These rodent species have undergone longstanding radiation across diverse habitats, likely resulting in adaptations in their mitochondrial genomes. Understanding these adaptations could inform the interpretation of human MT-ND3 variants and their potential pathogenicity.

The geographic genetic variation documented in Reithrodontomys populations also offers opportunities to study how environmental factors might influence mitochondrial gene evolution, potentially revealing adaptive mechanisms relevant to human mitochondrial function under varying conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.