The Recombinant Renibacterium salmoninarum Large-conductance mechanosensitive channel (mscL) is a protein derived from the bacterium Renibacterium salmoninarum, which is known for causing bacterial kidney disease (BKD) in salmonid fish. This protein is part of a family of mechanosensitive channels that play crucial roles in maintaining cellular osmotic balance by responding to changes in membrane tension. The recombinant form of this protein is produced through genetic engineering techniques, allowing for its use in various research applications, including studies on bacterial pathogenesis and the development of diagnostic tools.
Protein Structure and Function: The mscL protein is a large-conductance mechanosensitive channel, which means it can open in response to mechanical stress, such as changes in membrane tension, allowing ions to flow through the cell membrane. This function is essential for bacterial survival under osmotic stress conditions.
Sequence Information: The protein sequence of mscL from Renibacterium salmoninarum includes specific amino acid motifs that are characteristic of mechanosensitive channels. The sequence provided in one source includes the amino acids MIKGFRDFILKGNVVDLAVAVVIGAAFGTVVTTLVNNIIMPLIAGIVGKPSFNDVWAFQI GSDPANKLLLGAFITVLLNFVIIAAAIYFMVVVPMNHVIARRNAKLGIKAGEETPDPQIV LLTEIRDALKSRS .
Production and Storage: The recombinant mscL protein is typically produced in a suitable host organism and purified for use in research. It is stored in a Tris-based buffer with 50% glycerol at -20°C to maintain stability .
KEGG: rsa:RSal33209_1734
STRING: 288705.RSal33209_1734
Renibacterium salmoninarum is a Gram-positive, intracellular pathogen that causes Bacterial Kidney Disease (BKD) in numerous fish species in both freshwater and seawater environments. This pathogen has significant importance as it primarily affects salmonids, including Atlantic salmon (Salmo salar), chinook salmon (Oncorhynchus tshawytscha), and rainbow trout (Oncorhynchus mykiss) . R. salmoninarum has been detected in other species as well, including Arctic char (Salvelinus alpinus L.), Pacific herring (Clupea pallasii pallasii), and even non-salmonids like sablefish (Anoplopoma fimbria) .
The bacterium causes a chronic, systemic condition characterized by granulomatous lesions, primarily affecting the kidney and other internal organs . BKD poses a significant threat to both aquaculture and wild salmon conservation efforts, with infection prevalences among some hatchery populations approaching 100%, and wild salmon populations showing infection rates exceeding 30% in some areas .
The major virulence factor identified in R. salmoninarum is p57 (also designated MSA for major soluble antigen), a 57 kDa protein that is abundantly expressed and primarily localized on the bacterial cell surface, with significant levels also released into the extracellular environment . This protein is encoded by the msa gene, which is present in two identical copies (msa1 and msa2) in the R. salmoninarum genome .
Research indicates that p57/MSA is immunodominant and plays a crucial role in the pathogenesis of BKD. Studies comparing virulent and attenuated strains of R. salmoninarum have shown differential expression of p57, with attenuated strains producing lower levels of this protein . This suggests that p57 expression correlates with virulence, making it an important target for research on pathogenesis mechanisms and potential vaccine development.
Several experimental challenge models have been developed to study R. salmoninarum infections:
Intraperitoneal (i.p.) injection: This direct challenge method involves injecting bacterial suspensions (typically 5 × 10^6 to 5 × 10^7 CFU per fish) into the peritoneal cavity after anesthetizing fish with tricaine methane sulfonate (TMS/MS222) . This approach ensures a controlled bacterial dose but bypasses natural infection barriers.
Cohabitation challenge: This model simulates natural transmission by introducing infected "shedder" fish (typically marked by fin clipping and injected with R. salmoninarum) with naïve fish. A common ratio is 20% shedders to 80% naïve fish .
Waterborne exposure: Infection can be established by introducing R. salmoninarum into the water inflow of experimental tanks, creating a more natural infection route .
Oral challenge: Studies have demonstrated that the fecal-oral route may contribute significantly to horizontal transmission. Experimental oral challenges using R. salmoninarum-laden feces have resulted in significantly higher mortality and prevalence of infection compared to control groups .
These models allow researchers to study different aspects of infection dynamics, including transmission routes, dose-dependent responses, and host-pathogen interactions in various water conditions (freshwater vs. brackish/seawater).
Multiple molecular techniques have been developed for R. salmoninarum detection, each with specific advantages:
Real-time quantitative PCR (qPCR): A highly sensitive method that amplifies a 69-base pair region of the gene encoding MSA. This technique can consistently detect as few as 5 R. salmoninarum cells per reaction in kidney tissue . The qPCR approach uses TaqMan technology with fluorescent probes and provides quantitative results, allowing researchers to determine bacterial load.
Nested PCR: This two-step amplification method enhances sensitivity for detecting low bacterial loads. In comparative studies, nested PCR showed a detection prevalence of approximately 66% in naturally infected populations .
Enzyme-linked immunosorbent assay (ELISA): This protein-based detection method targets the MSA/p57 protein and has shown comparable detection rates to qPCR (both around 71% in naturally infected populations) .
For optimal research outcomes, a combination of these methods is recommended. Each technique provides different information: qPCR offers quantification and high sensitivity, nested PCR provides high sensitivity for determining presence/absence, and ELISA detects the expressed protein rather than genetic material.
Table 1: Comparison of detection methods for R. salmoninarum
| Method | Target | Sensitivity | Quantitative | Advantages | Limitations |
|---|---|---|---|---|---|
| qPCR | MSA gene | ~5 cells/reaction | Yes | High sensitivity, quantitative results | Requires specialized equipment |
| Nested PCR | Various gene targets | Very high | No | Extremely sensitive for low bacterial loads | Risk of contamination, not quantitative |
| ELISA | p57/MSA protein | Moderate | Semi-quantitative | Detects expressed protein | Can have cross-reactivity with other antigens |
When expressing recombinant proteins from R. salmoninarum, including potential mechanosensitive channels like mscL, several optimization strategies should be considered:
Vector selection: Reporter plasmids with strong promoters have been successfully used for R. salmoninarum protein expression. For example, reporter plasmids encoding a fusion of MSA and green fluorescent protein (GFP) controlled by 0.6 kb of promoter region have shown effective protein expression .
Transformation approach: Successful transformation and homologous recombination have been demonstrated in R. salmoninarum . This genetic manipulation approach allows for the integration of reporter constructs into the chromosome, leading to stable expression. For mechanosensitive channels, creating fusion proteins with fluorescent tags can help visualize localization and function.
Expression analysis: Both mRNA and protein expression should be monitored. For mRNA analysis, real-time PCR can be employed, while protein expression can be assessed through techniques like Western blotting with specific antibodies, as demonstrated for p57 detection .
Functional analysis: For mechanosensitive channels, electrophysiological techniques or osmotic shock assays may be necessary to verify channel functionality after recombinant expression.
R. salmoninarum possesses duplicate copies of the msa gene (msa1 and msa2), which presents unique challenges for researchers studying gene expression and protein function . Key considerations include:
While specific information about mscL in R. salmoninarum is limited in the provided research, mechanosensitive channels generally serve important functions in bacterial physiology and pathogenesis:
Osmotic regulation: As R. salmoninarum can infect fish in both freshwater and seawater environments , mechanosensitive channels likely play a critical role in adapting to changing osmotic conditions. These channels act as pressure relief valves during osmotic downshock, preventing cell lysis.
Potential contributions to pathogenesis:
Environmental sensing: Mechanosensitive channels may help the bacterium detect and respond to the host environment during infection.
Persistence mechanisms: The ability to survive osmotic stress could contribute to R. salmoninarum's ability to persist in various host tissues and environments.
Interface with virulence factors: Research could investigate potential interactions between mechanosensitive channels and known virulence factors like p57/MSA.
Research approaches:
Gene knockout studies: Creating mscL deletion mutants to assess changes in virulence and environmental tolerance.
Electrophysiology: Characterizing channel properties in recombinant expression systems.
Infection studies: Comparing wild-type and mscL mutant strains in experimental infection models to determine the contribution of these channels to pathogenesis.
R. salmoninarum is notoriously difficult to culture, which presents challenges for experimental studies . Researchers should consider the following methodological approaches:
Media selection: Specialized media such as KDM2 (kidney disease medium 2) or SKDM (selective kidney disease medium) are typically required for primary isolation and cultivation.
Growth conditions:
Temperature: 15-18°C is optimal for growth
Incubation time: R. salmoninarum is slow-growing, often requiring 2-6 weeks for visible colony formation
Atmosphere: Aerobic conditions with high humidity
Strain preservation: Maintaining virulent characteristics during laboratory passage is challenging. Studies have shown that repeated subculturing can lead to attenuation, as evidenced by decreased p57 expression . Researchers should:
Minimize passage number
Store bacterial stocks at -80°C in glycerol
Verify virulence characteristics (such as p57 expression) periodically
Authentication: PCR-based identification targeting the msa gene is recommended to confirm isolate identity.
Horizontal transmission is an important aspect of R. salmoninarum epidemiology. Research has shown that fecal-oral routes may contribute significantly to transmission . Effective experimental designs include:
Cohabitation studies: These simulate natural transmission dynamics by placing infected "shedder" fish with naïve recipient fish. Critical parameters include:
Water sampling: Detection of viable R. salmoninarum in water can help quantify shedding rates. Research has confirmed that viable bacteria can be found in the seawater of net pens containing infected fish .
Survival studies: Examining bacterial survival in different water types is important, as research indicates R. salmoninarum can survive in seawater long enough for horizontal transmission to occur .
Oral challenge: Experimental oral administration of R. salmoninarum-laden feces has successfully produced infection, supporting the fecal-oral transmission hypothesis . This model can be used to study dose-dependent effects and infection dynamics.
Monitoring approaches: Regular sampling using non-lethal or lethal methods, combined with sensitive detection techniques (qPCR, ELISA), allows for tracking infection progression over time.
Quantitative PCR (qPCR) is a valuable tool for R. salmoninarum detection and quantification , but proper analysis requires careful consideration:
Data categorization: For practical interpretation, qPCR results (Ct values) can be grouped into categories reflecting infection intensity:
Standard curve development: To convert Ct values to bacterial cell numbers, standard curves should be created using known quantities of R. salmoninarum. The qPCR assay has been shown to consistently detect as few as 5 R. salmoninarum cells per reaction in kidney tissue .
Controls and validation:
Comparative analysis: When possible, compare qPCR results with other detection methods (ELISA, nested PCR, culture) to validate findings. In studies of naturally infected populations, qPCR, nested PCR, and ELISA showed detection rates of 71%, 66%, and 71%, respectively .
Based on current understanding of R. salmoninarum biology and pathogenesis, several promising research directions emerge:
Targeted vaccines: Development of recombinant subunit vaccines focusing on immunodominant antigens like p57/MSA. Understanding of the duplicated msa genes and their expression products could inform more effective antigen design .
Virulence attenuation mechanisms: Research comparing virulent and attenuated strains has shown differential expression of p57 . Further study of the mechanisms underlying attenuation could lead to live attenuated vaccine candidates or therapeutic approaches targeting virulence pathways.
Transmission intervention: Given the importance of horizontal transmission, particularly via the fecal-oral route , developing strategies to interrupt transmission in aquaculture settings could significantly reduce disease impact.
Mechanosensitive channel targeting: Further characterization of mechanosensitive channels like mscL could reveal their role in environmental adaptation and potentially identify them as novel therapeutic targets if they prove essential for bacterial survival or virulence.
Genetic manipulation tools: Continued refinement of transformation and homologous recombination techniques for R. salmoninarum will facilitate more sophisticated genetic studies, including site-directed mutagenesis and gene knockout approaches to identify essential genes and pathways.