Recombinant Renibacterium salmoninarum Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock
Cat. No.
BT2506788
Source
in vitro E.coli expression system
Synonyms
crcB; RSal33209_1373; Putative fluoride ion transporter CrcB
Quick Inquiry

Description

Introduction to Recombinant Renibacterium salmoninarum Protein CrcB Homolog (crcB)

The Recombinant Renibacterium salmoninarum Protein CrcB homolog (crcB) is a protein of interest due to its potential role in mitigating fluoride toxicity, although specific information about its recombinant form in Renibacterium salmoninarum is limited. Renibacterium salmoninarum is a Gram-positive bacterium known for causing bacterial kidney disease in salmonid fish . The crcB gene is commonly associated with fluoride riboswitches in various bacteria and archaea, where it is involved in regulating genes that help counteract fluoride toxicity .

Background on Fluoride Riboswitches and CrcB Proteins

Fluoride riboswitches are RNA structures that sense fluoride ions and regulate downstream genes, including those encoding CrcB proteins. These proteins are proposed to function as fluoride transporters, helping to reduce intracellular fluoride levels . In bacteria like Pseudomonas putida, the absence of crcB significantly increases sensitivity to fluoride, highlighting its protective role .

Research Findings on CrcB Proteins

OrganismRole of CrcBFluoride Concentration Impact
E. coliFluoride transportImpaired growth at 50 mM fluoride
Pseudomonas putidaFluoride resistanceGrowth suppressed above 0.5 mM fluoride in ΔcrcB mutant
Streptococcus mutansFluoride resistanceEncodes EriC^F^ proteins instead of CrcB

Potential Applications and Future Research

While specific studies on the recombinant Renibacterium salmoninarum Protein CrcB homolog are lacking, understanding its role in fluoride resistance could provide insights into developing strategies for managing fluoride toxicity in various organisms. Further research is needed to explore its potential applications in biotechnology and environmental science.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; RSal33209_1373; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Target Names
crcB
Target Protein Sequence
MIVIFVGLAGVLGALMRFGLDSFFAQRGRFAHGQAHHFPLATLSVNVLGSFIIGLAGGFA SHAELSPDWHSAISIGIAGGLTTFSSFAVATVSLWQLGNKFSAMVNIGLNLVLGLGAAWL GLSLAA
Uniprot No.
A9WPV3

Target Background

Function
Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.
Database Links

KEGG: rsa:RSal33209_1373

STRING: 288705.RSal33209_1373

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.