Recombinant Respiratory nitrate reductase 2 gamma chain (narV)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
narV; Z2247; ECs2068; Respiratory nitrate reductase 2 gamma chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
narV
Target Protein Sequence
MIQYLNVFFYDIYPYICATVFFLGSWLRYDYGQYTWRASSSQMLDKRGMVIWSNLFHIGI LGIFFGHLFGMLTPHWMYAWFLPVAAKQLMAMVLGGICGVLTLIGGAGLLWRRLTNQRVR ATSTTPDIIIMSILLIQCLLGLSTIPFSAQYPDGSEMMKLVGWAQSIVTFRGGSSEMLNG VAFVFRLHLVLGMTIFLLFPFTRLVHVWSAPFEYFTRRYQIVRSRR
Uniprot No.

Target Background

Function
This is a second nitrate reductase enzyme that can substitute for the NRA enzyme, enabling E. coli to utilize nitrate as an electron acceptor during anaerobic growth. The gamma chain is a membrane-embedded heme-iron unit resembling cytochrome b, responsible for transferring electrons from quinones to the beta subunit.
Database Links

KEGG: ece:Z2247

STRING: 155864.Z2247

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the genetic organization of respiratory nitrate reductase operons influence narV expression?

Nitrate reductase operons are typically organized as polycistronic transcriptional units, as seen with the narGHJI operon in P. fluorescens . This arrangement ensures coordinated expression of all subunits. Any transcriptional termination or regulatory elements within the operon can significantly affect downstream gene expression, as demonstrated in studies where disruption of narG affected downstream gene expression in the operon .

When studying narV, researchers should consider:

  • Promoter mapping experiments to identify transcription start sites

  • Reporter gene fusions to quantify expression under different conditions

  • Northern blot analysis to detect polycistronic mRNA transcripts

  • Quantitative RT-PCR to measure relative expression of different subunits

What are the optimal approaches for cloning and expressing recombinant narV for functional studies?

Based on techniques used for related nitrate reductase subunits, the following methodological approaches are recommended:

Expression system selection:

Expression SystemAdvantagesLimitationsBest Applications
E. coli BL21(DE3)High yield, ease of useMay not form proper cofactorsInitial structural studies
P. fluorescens derivativesNative environment, proper foldingLower yield, more complexFunctional studies
Cell-free systemsRapid, avoids toxicityExpensive, limited scaleQuick screening

Purification strategy:

  • Design a construct with an appropriate affinity tag (His6 or Strep-tag)

  • Use mild detergents for solubilization if membrane-associated

  • Implement metal affinity chromatography followed by size exclusion

  • Consider co-expression with other subunits to maintain stability

  • Verify protein identity via mass spectrometry and Western blotting

How can gene disruption methods be optimized for studying the function of narV?

Drawing from successful approaches with narG, researchers can design similar strategies for narV:

  • Create a deletion construct with a selectable marker (e.g., gentamicin resistance cassette as used for narG)

  • Design primers that target conserved regions flanking narV

  • Use homologous recombination for precise gene replacement

  • Verify disruption using Southern blot analysis with appropriate probes

  • Confirm the phenotype with complementation studies using a wild-type copy of narV

  • Analyze the impact on nitrate reduction and growth under anaerobic conditions

What experimental approaches can reveal the regulatory relationships between narV and the denitrification pathway?

Based on studies of narG in P. fluorescens, disruption of one component can have regulatory effects on other parts of the pathway . To investigate regulatory relationships:

  • Monitor growth kinetics under different respiratory conditions (aerobic, anaerobic with nitrate, nitrite, or N₂O)

  • Measure enzyme activities across the denitrification pathway in wild-type vs. narV mutants

  • Perform transcriptome analysis to identify genes affected by narV disruption

  • Use reporter gene fusions to monitor expression of other denitrification genes in response to narV mutation

  • Conduct chromatin immunoprecipitation to identify potential regulatory protein interactions

What are the most reliable methods for assessing the enzymatic activity of recombinant narV and nitrate reductase complexes?

Several complementary approaches can be used to assess activity:

Spectrophotometric assays:

  • Benzyl viologen oxidation assay – measures electron transfer activity

  • Methyl viologen reduction assay – monitors nitrate-dependent electron consumption

  • Nitrite production assay – directly quantifies the product of nitrate reduction

Data analysis considerations:

  • Establish appropriate controls including heat-inactivated enzyme

  • Perform Michaelis-Menten kinetics analysis to determine Km and Vmax

  • Compare activity across different pH and temperature conditions

  • Analyze the effects of potential inhibitors on activity

  • Assess the impact of different electron donors on reaction rates

How should growth data be analyzed when comparing wild-type and narV mutant strains?

When analyzing growth patterns of nitrate reductase mutants as demonstrated in narG studies :

What statistical approaches help resolve contradictions in nitrate reductase functional data?

When faced with contradictory results in nitrate reductase studies:

  • Implement factorial experimental designs to identify interaction effects between variables

  • Use ANOVA with post-hoc tests to determine significant differences between conditions

  • Apply non-parametric tests when data doesn't meet assumptions of normality

  • Consider Bayesian statistical approaches for complex datasets

  • Use principal component analysis to identify patterns in multivariate data

  • Implement meta-analysis techniques when combining results from multiple studies

  • Apply multivariate regression to model relationships between multiple variables

How can structural biology approaches enhance our understanding of narV's role in nitrate reductase complexes?

Advanced structural biology techniques can provide crucial insights:

  • X-ray crystallography of the isolated narV subunit and the complete complex

    • Requires high-purity protein samples and optimization of crystallization conditions

    • Can reveal atomic-level details of protein structure and interaction surfaces

  • Cryo-electron microscopy (cryo-EM)

    • Especially useful for large membrane protein complexes

    • Can capture different conformational states during catalytic cycle

    • Sample preparation protocols must preserve native structure

  • Nuclear magnetic resonance (NMR) spectroscopy

    • Best for smaller domains or regions of narV

    • Can provide dynamics information not available from static structures

    • Requires isotope labeling (¹⁵N, ¹³C) of recombinant protein

  • Small-angle X-ray scattering (SAXS)

    • Provides low-resolution structural information in solution

    • Useful for studying conformational changes upon substrate binding

    • Requires minimal sample amounts compared to crystallography

What approaches can be used to identify critical residues in narV through site-directed mutagenesis?

A systematic approach to identifying functional residues includes:

  • Sequence analysis and conservation mapping

    • Align narV sequences across species to identify highly conserved residues

    • Use structural modeling to predict functionally important regions

  • Alanine scanning mutagenesis

    • Systematically replace conserved residues with alanine

    • Evaluate impact on enzyme activity, complex formation, and stability

  • Charge-swap experiments

    • Replace charged residues with oppositely charged ones

    • Particularly useful for identifying residues involved in protein-protein interactions

  • Cysteine accessibility experiments

    • Introduce cysteine residues at strategic positions

    • Use thiol-reactive probes to assess solvent accessibility

  • Data analysis considerations:

    • Compare mutant activities as percentage of wild-type function

    • Analyze protein stability using thermal shift assays

    • Consider structural context when interpreting results

How can systems biology approaches integrate narV function into broader metabolic networks?

Systems biology provides tools to understand the broader context of narV function:

What are common challenges in expressing recombinant narV, and how can they be addressed?

Researchers often encounter several challenges when working with recombinant nitrate reductase subunits:

Protein solubility issues:

  • Optimize induction conditions (temperature, IPTG concentration, duration)

  • Test different solubilization buffers with varying detergents

  • Consider fusion tags that enhance solubility (MBP, SUMO, GST)

  • Explore refolding protocols from inclusion bodies if necessary

  • Co-express with chaperones to facilitate proper folding

Protein stability problems:

  • Include appropriate protease inhibitors during purification

  • Optimize buffer composition (pH, salt concentration, glycerol)

  • Test different storage conditions (temperature, additives)

  • Consider stabilizing ligands or cofactors in buffers

  • Monitor stability via thermal shift assays

How can researchers verify proper folding and incorporation of recombinant narV into functional complexes?

Verification of proper folding and complex formation is critical:

  • Circular dichroism (CD) spectroscopy

    • Assess secondary structure content

    • Compare with predicted structural elements

  • Size exclusion chromatography

    • Analyze oligomeric state and complex formation

    • Compare elution profiles with native complexes

  • Co-immunoprecipitation assays

    • Verify interactions with other nitrate reductase subunits

    • Identify potential binding partners

  • Limited proteolysis

    • Well-folded proteins show distinct proteolytic patterns

    • Compare recombinant protein with native protein digestion profiles

  • Activity assays

    • Test functional complementation in mutant strains

    • Measure enzymatic activity of reconstituted complexes

What strategies help optimize anaerobic experimental conditions for studying narV function?

The study of nitrate reductase requires careful maintenance of anaerobic conditions:

  • Chamber design and monitoring

    • Use anaerobic chambers with continuous monitoring of O₂ levels

    • Include oxygen scavenging systems (palladium catalysts, reducing agents)

  • Media preparation considerations

    • Pre-reduce media by boiling and cooling under N₂ gas

    • Include resazurin as a redox indicator to monitor anaerobiosis

    • Add reducing agents like cysteine or thioglycolate

  • Sample handling techniques

    • Use gas-tight syringes for transfers

    • Minimize exposure to air during sampling

    • Flush all containers with N₂ or Ar before use

  • Experimental validation

    • Include obligate aerobes and anaerobes as controls

    • Monitor redox potential continuously during experiments

    • Validate anaerobic conditions biochemically (e.g., activity of O₂-sensitive enzymes)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.