Recombinant Rhea americana Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments default to blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Rhea americana (Greater rhea) (Common rhea)
Target Names
Target Protein Sequence
AICSLVLYLLSLMLMEKLSSNTVDAQEVELIWTILPAIVLILLALPSLQILYMMDEIDEP DLTLKAIGHQWYWSYEYTDFKDLAFDSYMIPTTELPSGHFRLLEVDHRVVVPMESPIRVI VTAGDVLHSWAVPTLGVKTDAIPGRLNQTSFITTRPGIFYGQCSEICGANHSYMPIVVES TPLAHFESWSSLLSSSSSL
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation by facilitating electron transfer from reduced cytochrome c to molecular oxygen, producing water. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase. Within cytochrome c oxidase, electrons are transferred via the Cu(A) center and heme A to the binuclear center (heme A3 and Cu(B)), where oxygen is reduced to water, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Rhea americana Cytochrome c Oxidase Subunit 2 and what is its role in cellular respiration?

Rhea americana (greater rhea) Cytochrome c Oxidase Subunit 2 (MT-CO2) is a mitochondrially encoded protein component of respiratory chain complex IV. It plays a crucial role in the electron transport chain, specifically in the transfer of electrons from cytochrome c to molecular oxygen.

Similar to MT-CO2 in other species, the Rhea americana variant serves as the initial acceptor of electrons from cytochrome c, containing the binuclear CuA center that facilitates this electron transfer . The protein is essential for oxidative phosphorylation and ATP production, as it catalyzes the reduction of oxygen to water using electrons from cytochrome c in the intermembrane space and protons from the mitochondrial matrix .

How does Rhea americana MT-CO2 structurally compare to MT-CO2 from other avian and mammalian species?

Rhea americana MT-CO2, as a ratite bird protein, shows evolutionary conservation of key functional domains while exhibiting species-specific variations. The protein contains:

  • Conserved aromatic regions essential for electron transfer function

  • Metal-binding domains for the CuA center

  • Transmembrane helices that anchor the protein in the mitochondrial inner membrane

Comparative analysis with mammalian MT-CO2 shows that while the core catalytic domains remain highly conserved, there are species-specific variations particularly in:

FeatureRhea americana MT-CO2Mammalian MT-CO2 (e.g., Human)
Protein Length~227 amino acids227 amino acids
Conserved DomainsCuA binding site, aromatic regionCuA binding site, aromatic region
Key ResiduesConserved tryptophan in electron transfer domainConserved tryptophan in electron transfer domain
Species VariationUnique residues in non-catalytic regionsHigher glycosylation patterns

Notable differences can be observed in non-catalytic regions, reflecting evolutionary adaptation to different metabolic requirements and environmental conditions .

What are the expected physicochemical properties of recombinant Rhea americana MT-CO2?

Recombinant Rhea americana MT-CO2 protein has several key physicochemical properties researchers should be aware of:

  • Molecular Weight: ~25-30 kDa (depending on tag and expression system)

  • Isoelectric Point: Typically between 4.5-5.5

  • Stability: Moderately stable at 4°C; should be stored at -20°C or -80°C for long-term storage

  • Buffer Compatibility: Usually stable in Tris/PBS-based buffers (pH 7.5-8.0)

  • Cofactor Requirements: Requires copper ions for proper folding and function

  • Solubility: May require detergents or specialized solubilization methods due to its transmembrane domains

When expressed with a His-tag, as commonly done for purification purposes, researchers should expect the protein to be amenable to purification by immobilized metal affinity chromatography (IMAC) .

What are the optimal expression systems for producing recombinant Rhea americana MT-CO2?

The optimal expression system depends on research objectives, but several systems have proven successful:

E. coli Expression System:

  • Advantages: High yield, cost-effective, rapid expression

  • Considerations: Lacks post-translational modifications, may form inclusion bodies

  • Recommended strains: BL21(DE3), Rosetta(DE3) for rare codon optimization

  • Expression conditions: Induction with 0.1-1.0 mM IPTG at 16-18°C for 16-20 hours to maximize proper folding

Insect Cell System:

  • Advantages: Better post-translational modifications, improved folding

  • Recommended: Sf9 or High Five™ cells with baculovirus expression system

  • Yield: Typically 2-5 mg/L of culture

Mammalian Expression System:

  • Advantages: Most authentic post-translational modifications and folding

  • Considerations: Lower yield, higher cost, longer production time

  • Recommended: HEK293 or CHO cells

For most biochemical and structural studies, E. coli-expressed protein with appropriate solubilization and refolding protocols has proven sufficient .

What purification strategy is recommended for obtaining high-purity recombinant Rhea americana MT-CO2?

A multi-step purification strategy is recommended for obtaining high-purity recombinant Rhea americana MT-CO2:

  • Initial Capture: Immobilized Metal Affinity Chromatography (IMAC)

    • Use Ni-NTA or Co-NTA resins for His-tagged protein

    • Buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10-20 mM imidazole

    • Elution: 250-300 mM imidazole gradient

  • Intermediate Purification: Ion Exchange Chromatography

    • Use cation or anion exchange depending on the protein's pI

    • Buffer: 20 mM Tris-HCl pH 7.5-8.0, 50 mM NaCl

    • Elution: NaCl gradient (50-500 mM)

  • Polishing Step: Size Exclusion Chromatography

    • Recommended column: Superdex 75 or 200

    • Buffer: 20 mM Tris-HCl pH 8.0, 150 mM NaCl, 5% glycerol

Expected purity: >90% as determined by SDS-PAGE

For storage, the purified protein should be maintained in a buffer containing 20 mM Tris-HCl pH 8.0, 150 mM NaCl, with 6% trehalose or 10% glycerol to preserve stability, and stored at -80°C .

How can I optimize solubility of recombinant Rhea americana MT-CO2 during expression?

Optimizing solubility of recombinant Rhea americana MT-CO2 requires attention to several factors:

Expression Conditions Optimization:

  • Lower induction temperature (16-18°C)

  • Reduce IPTG concentration (0.1-0.2 mM)

  • Extend expression time (18-24 hours)

  • Use enriched media like Terrific Broth

Genetic Strategies:

  • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

  • Express as fusion protein with solubility enhancers (MBP, SUMO, or Thioredoxin)

  • Optimize codon usage for E. coli expression

Buffer Optimization:

  • Include mild detergents (0.1% Triton X-100 or 0.5% CHAPS)

  • Add stabilizing agents (10% glycerol, 50-100 mM L-arginine)

  • Ensure presence of copper ions (1-5 μM CuSO₄)

  • Maintain reducing environment (1-5 mM DTT or 2-5 mM β-mercaptoethanol)

If inclusion bodies form despite optimization, develop a refolding protocol using stepwise dialysis with decreasing concentrations of urea or guanidine-HCl .

How can I assess the electron transfer activity of recombinant Rhea americana MT-CO2?

Assessing electron transfer activity of recombinant Rhea americana MT-CO2 can be performed using several complementary techniques:

Spectrophotometric Cytochrome c Oxidation Assay:

  • Prepare reaction buffer: 50 mM phosphate buffer, pH 7.4

  • Add reduced cytochrome c (final concentration: 50 μM)

  • Add purified MT-CO2 protein (0.5-5 μg)

  • Monitor decrease in absorbance at 550 nm over time

  • Calculate activity using extinction coefficient (ΔE₅₅₀ = 21.84 mM⁻¹cm⁻¹)

Polarographic Oxygen Consumption Measurement:

  • Use Clark-type oxygen electrode

  • Reaction mixture: 10-50 μg protein in 50 mM phosphate buffer with substrates

  • Record oxygen consumption rate at 25°C

  • Calculate activity as nmol O₂ consumed/min/mg protein

Electron Transfer Rate Using Stopped-Flow Spectroscopy:

  • Mix rapidly reduced cytochrome c with MT-CO2

  • Monitor spectral changes in millisecond timeframe

  • Determine rate constants for electron transfer events

The functionality can be further validated by comparing activity in the presence of specific inhibitors like azide or cyanide, which should diminish the electron transfer capacity .

What experimental approaches can be used to study the copper binding properties of Rhea americana MT-CO2?

Copper binding properties of Rhea americana MT-CO2 can be studied using multiple complementary approaches:

Isothermal Titration Calorimetry (ITC):

  • Titrate CuSO₄ solution into protein sample

  • Measure heat changes during binding events

  • Determine binding constants, stoichiometry, and thermodynamic parameters

  • Typical conditions: 20-50 μM protein, 0.5-1 mM copper solution

UV-Visible Spectroscopy:

  • Monitor spectral changes in 450-700 nm range

  • Cu(II) binding creates characteristic absorption peaks

  • Calculate binding parameters from spectral changes

Electron Paramagnetic Resonance (EPR) Spectroscopy:

  • Prepare protein samples with varying Cu(II) concentrations

  • Record EPR spectra at low temperature (typically 77K)

  • Analyze hyperfine coupling patterns specific to Cu-binding sites

Circular Dichroism (CD) Spectroscopy:

  • Record CD spectra before and after copper addition

  • Observe changes in secondary structure upon metal binding

  • Use near-UV CD (250-350 nm) to monitor tertiary structure changes

These techniques provide complementary information about copper binding affinity, coordination geometry, and the effects of binding on protein structure .

How can researchers assess the thermal stability of recombinant Rhea americana MT-CO2?

The thermal stability of recombinant Rhea americana MT-CO2 can be assessed using the following methods:

Differential Scanning Fluorimetry (DSF/Thermofluor):

  • Mix protein with environment-sensitive fluorescent dye (SYPRO Orange)

  • Apply temperature gradient (25-95°C)

  • Monitor fluorescence changes as protein unfolds

  • Determine melting temperature (Tm) from inflection point

  • Compare Tm values under different buffer conditions

Circular Dichroism (CD) Thermal Denaturation:

  • Monitor CD signal at 222 nm while increasing temperature

  • Plot signal change vs. temperature

  • Calculate Tm from the midpoint of transition curve

  • Assess reversibility by cooling and reheating

Dynamic Light Scattering (DLS) Thermal Stability:

  • Monitor hydrodynamic radius at increasing temperatures

  • Detect onset of aggregation

  • Determine aggregation temperature (Tagg)

Activity Assay at Various Temperatures:

  • Perform electron transfer activity assay at temperature range (4-60°C)

  • Plot activity vs. temperature

  • Determine temperature optimum and stability range

For Rhea americana MT-CO2, typical thermal stability data might show a melting temperature around 50-60°C in optimal buffer conditions, with significant destabilization in the absence of copper ions .

How can recombinant Rhea americana MT-CO2 be used in evolutionary studies of respiratory proteins?

Recombinant Rhea americana MT-CO2 provides valuable insights for evolutionary studies of respiratory proteins through several research approaches:

Comparative Sequence Analysis:

  • Align MT-CO2 sequences from ratites (rhea, ostrich, emu) and non-ratite birds

  • Identify conserved regions across avian lineages

  • Calculate evolutionary rates in different protein domains

  • Map selection pressures using dN/dS ratios

Biochemical Comparison Studies:

  • Compare kinetic parameters of electron transfer across species

  • Assess thermal and pH optima differences between avian and mammalian MT-CO2

  • Analyze species-specific copper binding affinities

Structural Comparative Analysis:

  • Create homology models of Rhea MT-CO2 based on known structures

  • Identify structural adaptations in the electron transfer domains

  • Correlate structural differences with metabolic adaptations

Research by Tigriopus californicus researchers demonstrated that MT-CO2 shows nearly 20% divergence at the nucleotide level between populations, with about 4% of sites evolving under neutral selection (ω = 1), providing a model for studying adaptive evolution in respiratory proteins . Similar approaches can be applied to Rhea americana MT-CO2 to understand evolutionary adaptations in ratite birds.

How can recombinant Rhea americana MT-CO2 be utilized in structural biology studies?

Recombinant Rhea americana MT-CO2 can be utilized in multiple structural biology techniques:

X-ray Crystallography:

  • Optimize protein for crystallization by:

    • Removing flexible regions

    • Testing various detergents for membrane domain stability

    • Screening crystallization conditions (pH 6.5-8.0, PEG concentrations 10-20%)

  • Co-crystallize with natural binding partners or inhibitors

  • Determine structure at high resolution (ideally <2.5Å)

Cryo-Electron Microscopy (Cryo-EM):

  • Prepare protein in vitrified ice

  • Image using high-resolution electron microscope

  • Process data to generate 3D reconstruction

  • Particularly suitable for larger complexes containing MT-CO2

NMR Spectroscopy:

  • Prepare isotopically labeled protein (¹⁵N, ¹³C)

  • Focus on specific domains rather than full-length protein

  • Analyze dynamic properties and binding interactions

Small-Angle X-ray Scattering (SAXS):

  • Obtain low-resolution envelope of protein structure

  • Study conformational changes upon ligand binding

  • Analyze oligomeric states in solution

For membrane proteins like MT-CO2, incorporating the protein into nanodiscs or amphipols can significantly improve structural studies by maintaining the native-like lipid environment while enhancing solubility .

What is the potential role of Rhea americana MT-CO2 in studying mitochondrial diseases and dysfunction?

Rhea americana MT-CO2 serves as a valuable comparative model for studying mitochondrial diseases and dysfunction:

Conservation-Based Disease Modeling:

  • Identify conserved residues between human and Rhea MT-CO2

  • Introduce disease-associated mutations in recombinant Rhea protein

  • Assess functional consequences on electron transfer efficiency

  • Determine structural perturbations caused by mutations

Comparative Biochemical Studies:

  • Compare oxygen affinity and electron transfer rates between species

  • Identify species-specific adaptations that may inform therapeutic strategies

  • Study resistance mechanisms to oxidative stress

Drug Screening Applications:

  • Use recombinant Rhea MT-CO2 as an alternative target for screening cytochrome c oxidase modulators

  • Test species specificity of potential therapeutic compounds

  • Identify evolutionarily conserved binding sites for rational drug design

Research has shown that mutations in conserved aromatic residues of cytochrome c oxidase subunit II significantly impact cellular respiration and growth rates. Using recombinant Rhea americana MT-CO2, researchers can introduce equivalent mutations to study their effects on protein function and stability, providing insights into human mitochondrial diseases associated with MT-CO2 dysfunction .

What are common issues encountered when working with recombinant Rhea americana MT-CO2 and how can they be resolved?

Common issues and their solutions when working with recombinant Rhea americana MT-CO2:

Poor Expression Yields:

  • Issue: Low protein expression levels in E. coli

  • Solutions:

    • Optimize codon usage for expression host

    • Lower induction temperature (16-18°C)

    • Try alternate expression systems (insect cells)

    • Co-express with molecular chaperones

Protein Insolubility:

  • Issue: Formation of inclusion bodies

  • Solutions:

    • Express as fusion with solubility tags (MBP, SUMO)

    • Add mild detergents to lysis buffer (0.5-1% CHAPS)

    • Include 5-10% glycerol in buffers

    • Develop refolding protocol from inclusion bodies

Loss of Activity During Purification:

  • Issue: Reduced electron transfer activity

  • Solutions:

    • Include copper in purification buffers (1-5 μM CuSO₄)

    • Maintain reducing environment (1-2 mM DTT)

    • Minimize freeze-thaw cycles

    • Add stabilizers (trehalose 6%, glycerol 10%)

Protein Aggregation:

  • Issue: Protein forms aggregates during storage

  • Solutions:

    • Store at -80°C in single-use aliquots

    • Include 6% trehalose in storage buffer

    • Avoid repeated freeze-thaw cycles

    • Filter protein through 0.22 μm filter before storage

What quality control parameters should be monitored for recombinant Rhea americana MT-CO2 preparations?

Researchers should monitor these key quality control parameters for recombinant Rhea americana MT-CO2:

Purity Assessment:

  • SDS-PAGE analysis (target: >90% purity)

  • Size exclusion chromatography (assess monodispersity)

  • Mass spectrometry (confirm identity and detect modifications)

Functional Validation:

  • Electron transfer activity (cytochrome c oxidation assay)

  • Copper content analysis (atomic absorption spectroscopy)

  • Oxygen consumption measurements

Structural Integrity:

  • Circular dichroism (secondary structure confirmation)

  • Differential scanning fluorimetry (thermal stability)

  • Native PAGE (oligomeric state assessment)

Contaminant Testing:

  • Endotoxin testing (LAL assay, limit <0.1 EU/μg protein)

  • Nucleic acid contamination (A260/A280 ratio)

  • Protease contamination (fluorogenic substrate assay)

Quality control should be performed after purification and immediately before use in experiments. Acceptable specifications typically include:

  • Purity: >90% by SDS-PAGE

  • Activity: >70% of theoretical maximum

  • Endotoxin levels: <0.1 EU/μg protein

How should recombinant Rhea americana MT-CO2 be stored to maintain optimal activity?

Proper storage of recombinant Rhea americana MT-CO2 is critical for maintaining its functional integrity:

Short-term Storage (1-2 weeks):

  • Temperature: 4°C

  • Buffer composition: 20 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol

  • Additional stabilizers: 1 mM DTT (added fresh)

  • Container: Low-protein-binding tubes

Long-term Storage (months to years):

  • Temperature: -80°C (preferred) or -20°C

  • Buffer composition: 20 mM Tris/PBS-based buffer, pH 8.0, with 6% trehalose

  • Aliquoting: Divide into single-use aliquots (50-100 μL) to avoid freeze-thaw cycles

  • Flash-freezing: Use liquid nitrogen for rapid freezing

Reconstitution Guidelines:

  • Thaw aliquots rapidly at room temperature or on ice

  • Centrifuge briefly before opening tube (16,000 × g, 30 seconds)

  • For lyophilized protein, reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration for stability

Stability Monitoring:

  • Avoid more than 1-2 freeze-thaw cycles

  • Check activity after prolonged storage before experimental use

  • Monitor for precipitates before use

Research has shown that cytochrome c oxidase components typically retain >80% activity after 6 months at -80°C when stored with appropriate stabilizers like trehalose .

How can site-directed mutagenesis of Rhea americana MT-CO2 be used to study electron transfer mechanisms?

Site-directed mutagenesis of Rhea americana MT-CO2 provides powerful insights into electron transfer mechanisms:

Key Residues for Mutagenesis Analysis:

  • Copper-binding residues (histidine residues in CuA site)

  • Conserved aromatic residues in electron transfer pathway

  • Residues at the interface with cytochrome c

  • Evolutionarily variable positions across avian species

Recommended Mutagenesis Strategy:

  • Generate single point mutations using overlap extension PCR

  • Express and purify mutant proteins using identical protocols

  • Compare electron transfer kinetics between wild-type and mutants

  • Perform structural analysis of mutations using spectroscopic methods

Research on yeast cytochrome c oxidase demonstrated that alterations in conserved tryptophan residues dramatically reduced cellular respiration and growth rates on non-fermentable carbon sources, indicating their essential role in electron transfer. Similar studies on the conserved glycine residues showed they could be replaced with other small, uncharged residues without significant loss of function .

Potential mutations to explore in Rhea americana MT-CO2 include:

  • Tryptophan to phenylalanine (conservative) or alanine (disruptive)

  • Histidine to alanine in copper-binding sites

  • Glycine to alanine or valine in conserved regions

This approach can reveal the specific contributions of individual residues to the electron transfer mechanism and evolutionary adaptations in avian species.

What approaches are recommended for studying the interaction between Rhea americana MT-CO2 and cytochrome c?

Studying the interaction between Rhea americana MT-CO2 and cytochrome c requires multiple complementary approaches:

Binding Affinity Measurements:

  • Surface Plasmon Resonance (SPR):

    • Immobilize MT-CO2 on sensor chip

    • Flow cytochrome c at varying concentrations

    • Determine association and dissociation rate constants

    • Calculate equilibrium dissociation constant (KD)

  • Isothermal Titration Calorimetry (ITC):

    • Directly measure thermodynamic parameters

    • Determine binding stoichiometry

    • Typical conditions: 20-50 μM MT-CO2, titrate with 200-500 μM cytochrome c

Structural Characterization of the Complex:

  • Chemical Cross-linking coupled with Mass Spectrometry:

    • Use BS3 or EDC/NHS cross-linkers

    • Digest complex and analyze by LC-MS/MS

    • Identify residues at the interaction interface

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Compare deuterium uptake in free and complexed proteins

    • Identify regions protected upon complex formation

Functional Interaction Studies:

  • Electron Transfer Kinetics:

    • Stopped-flow spectroscopy to measure electron transfer rates

    • Compare kinetics with cytochrome c from different species

    • Determine effects of ionic strength and pH on interaction

  • Mutagenesis Studies:

    • Mutate predicted interface residues

    • Assess impact on binding affinity and electron transfer rates

These approaches can reveal the molecular basis of species-specific interactions between cytochrome c and MT-CO2, which is crucial for understanding evolutionary adaptations in the respiratory chain of different species .

How can comparative analysis between MT-CO2 from Rhea americana and other species inform our understanding of mitochondrial evolution?

Comparative analysis between MT-CO2 from Rhea americana and other species provides rich insights into mitochondrial evolution:

Multi-level Comparative Analysis Framework:

  • Sequence-Based Evolutionary Analysis:

    • Construct phylogenetic trees using MT-CO2 sequences

    • Calculate evolutionary rates in different protein domains

    • Identify sites under positive selection using maximum likelihood models

    • Research in Tigriopus californicus showed nearly 20% divergence at the nucleotide level between populations, with approximately 4% of sites evolving under relaxed selective constraint (ω = 1)

  • Structure-Function Relationship Analysis:

    • Map conserved vs. variable regions onto structural models

    • Correlate structural conservation with functional importance

    • Identify species-specific adaptations in electron transfer domains

  • Biochemical Adaptation Analysis:

    • Compare kinetic parameters across species

    • Analyze temperature and pH optima differences

    • Assess species-specific post-translational modifications

Recommended Comparative Panel:

  • Ratite birds: Rhea americana, Struthio camelus (ostrich), Dromaius novaehollandiae (emu)

  • Flying birds: Gallus gallus (chicken), Taeniopygia guttata (zebra finch)

  • Mammals: Homo sapiens, Mus musculus

  • Non-avian reptiles: Alligator mississippiensis

This comprehensive comparative approach can reveal:

  • Convergent evolution patterns in flightless birds

  • Metabolic adaptations related to flight capability or its loss

  • Lineage-specific selective pressures on respiratory function

  • Correlation between MT-CO2 evolution and ecological niches

The data from such studies contributes to our broader understanding of how mitochondrial proteins evolve in response to changing energy demands and environmental conditions across diverse vertebrate lineages .

What are the considerations for integrating recombinant Rhea americana MT-CO2 into artificial electron transport systems?

Integrating recombinant Rhea americana MT-CO2 into artificial electron transport systems requires careful consideration of several factors:

Protein Engineering Considerations:

  • Design fusion constructs with solubility enhancers or membrane anchors

  • Engineer surface residues for improved stability in artificial environments

  • Consider truncated versions retaining core electron transfer domains

  • Introduce unnatural amino acids for site-specific bioconjugation

Immobilization Strategies:

  • Direct Immobilization:

    • Covalent attachment using carbodiimide chemistry

    • His-tag mediated binding to Ni-NTA modified surfaces

    • Biotin-streptavidin linkage for oriented immobilization

  • Incorporation into Nanostructures:

    • Liposome or nanodisc integration for membrane domain stability

    • Attachment to carbon nanotubes or graphene for direct electron transfer

    • Integration with semiconductor nanoparticles for photoactivation

Electron Transfer Optimization:

  • Ensure proper orientation for efficient electron flow

  • Incorporate molecular wires for enhanced conductivity

  • Add copper centers for maintaining native-like electron transport

  • Control spatial organization for optimized electron transfer distances

Environmental Parameters:

  • Maintain hydration shell for protein function

  • Optimize buffer composition (pH 7.0-8.0, 100-150 mM NaCl)

  • Include stabilizers (5-10% glycerol, 1-2 mM reducing agents)

  • Control temperature (typically 25-37°C for optimal activity)

When designing such systems, balancing protein stability with electron transfer efficiency is critical. Studies with other cytochrome c oxidase components have shown that maintaining the copper centers in their native coordination environment is essential for preserving electron transfer functionality in artificial systems .

What reference standards and controls should be used in experiments with recombinant Rhea americana MT-CO2?

When conducting experiments with recombinant Rhea americana MT-CO2, appropriate reference standards and controls are essential:

Positive Controls:

  • Commercially available cytochrome c oxidase:

    • Bovine heart cytochrome c oxidase (widely characterized)

    • Recombinant human MT-CO2 (for comparative analysis)

  • Known active samples:

    • Previously validated batches of Rhea americana MT-CO2

    • Native enzyme purified from Rhea americana tissue (when available)

Negative Controls:

  • Inactivated enzyme preparations:

    • Heat-denatured MT-CO2 (95°C for 10 minutes)

    • Metal-depleted MT-CO2 (EDTA treatment)

  • Known inactive mutants:

    • Site-directed mutants lacking critical copper-binding residues

    • MT-CO2 with mutations in conserved aromatic residues

Assay-Specific Controls:

  • For activity assays:

    • Reactions without substrate

    • Reactions with specific inhibitors (azide, cyanide)

  • For binding studies:

    • Non-binding protein controls (e.g., BSA)

    • Competition with known binding partners

Reference Standards:

  • For quantification:

    • Purified protein standard curve (BSA) for protein concentration

    • Certified reference material for copper content analysis

  • For structural analysis:

    • Well-characterized protein standards for circular dichroism

    • Molecular weight markers for size exclusion chromatography

Using appropriate controls ensures experimental validity and facilitates accurate interpretation of results when working with this specialized recombinant protein .

What are the latest research trends and future directions in MT-CO2 studies that may apply to Rhea americana research?

Recent research trends and future directions in MT-CO2 studies that may be applicable to Rhea americana research include:

Emerging Research Trends:

  • Single-Molecule Studies:

    • Single-molecule FRET to track conformational changes during electron transfer

    • Nanoscale electrochemistry to measure electron transfer at individual protein level

    • Super-resolution microscopy to visualize MT-CO2 distribution in mitochondria

  • MT-CO2 in Metabolic Adaptation:

    • Recent discoveries show MT-CO2 involvement in glutaminolysis in glucose-deprived tumors

    • Glucose deprivation upregulates MT-CO2 expression through Ras signaling

    • MT-CO2 increases FAD levels, activating LSD1 to upregulate JUN transcription

  • Biomarker Applications:

    • MT-CO2 as a biomarker for mitochondrial dysfunction disorders

    • Expression patterns correlated with metabolic disease progression

    • Potential diagnostic applications in avian species

Future Research Directions:

  • CRISPR/Cas9 Genome Editing:

    • Creating precise mutations in MT-CO2 gene in cellular models

    • Studying effects of naturally occurring variations in protein function

    • Generating reporter systems for MT-CO2 expression and localization

  • Systems Biology Approaches:

    • Multi-omics integration (proteomics, metabolomics, transcriptomics)

    • Network analysis of MT-CO2 interactions in different metabolic states

    • Computational modeling of respiratory chain dynamics

  • Conservation Biology Applications:

    • Using MT-CO2 as a marker for population genetics in wild Rhea populations

    • Studying adaptations in respiratory function across different habitats

    • Assessing mitochondrial health in captive breeding programs

  • Therapeutic Target Exploration:

    • MT-CO2 as a potential target for metabolic disorders

    • Development of species-specific modulators of cytochrome c oxidase activity

    • Evolutionary insights informing drug design for human mitochondrial diseases

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.