Recombinant Rhinoceros unicornis Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Rhinoceros unicornis (Greater Indian rhinoceros)
Target Names
Target Protein Sequence
MAYPLQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINNPSLTIKTMGHQWYWSYEYTDYEDLTFDS YMIPTSDLKPGELRLLEVDNRVVLPMEMTIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QTTLISTRPGLYYGQCSEICGSNHSFMPIVLELVPLKHFEKWSTSML
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprising Complexes I-IV, facilitates oxidative phosphorylation by transferring electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the CuA center (subunit 2) and heme a (subunit 1) to the binuclear center (BNC) in subunit 1. The BNC, comprising heme a3 and CuB, reduces molecular oxygen to water using four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the optimal expression system for recombinant Rhinoceros unicornis MT-CO2 protein?

The optimal expression system for recombinant Rhinoceros unicornis MT-CO2 is Escherichia coli, particularly when using vectors like pET100/D-TOPO that incorporate N-terminal histidine tags for purification purposes. Research indicates that E. coli BL21 (DE3)pLysS cells are preferable host strains for cytochrome c oxidase subunit expression . Expression should be conducted at moderate temperatures (20-25°C) following IPTG induction (typically 0.5-1.0 mM) to maximize protein folding efficiency while minimizing inclusion body formation .

When expressing this mitochondrially-encoded protein, it's important to note that codon optimization for E. coli expression systems typically improves yield by 3-5 fold compared to the native sequence, as demonstrated in similar cytochrome c oxidase subunit expression studies .

What purification strategy yields the highest purity for recombinant MT-CO2?

A multi-step purification approach is recommended for achieving >95% purity of recombinant MT-CO2 protein:

  • Initial capture using nickel affinity chromatography (HIS-Select HF Nickel Affinity Gel) equilibrated with 0.02 M phosphate buffer (pH 8.0) containing 0.01 M imidazole and 0.5 M KCl

  • Elution with 0.02 M phosphate buffer (pH 8.0) containing 0.5 M KCl and 0.3 M imidazole

  • Dialysis against a storage buffer (typically Tris-based with 50% glycerol)

This approach consistently yields approximately 1.0 mg of purified recombinant enzyme from 1 L of bacterial culture with purity levels exceeding 95% as verified by SDS-PAGE analysis . The resulting protein typically has an apparent molecular mass of approximately 26-30 kDa when analyzed by SDS-PAGE .

How can I verify the functional activity of purified recombinant MT-CO2?

Functional verification of recombinant MT-CO2 can be performed using multiple complementary techniques:

  • Protonography: Following non-denaturing SDS-PAGE (samples mixed in loading buffer without 2-mercaptoethanol and not boiled), the gel can be subjected to protonography to detect hydratase activity. Active enzyme appears as a yellow band in the protonogram, confirming catalytic function .

  • Enzyme assay using stopped-flow spectrometry: Using phenol red (0.2 mM) as an indicator in 20 mM Tris buffer (pH 8.3) with 20 mM NaClO₄, measure absorbance at 557 nm while following the initial rate of the enzyme-catalyzed CO₂ hydration reactions (typically monitoring for 10-100 seconds) . This quantifies the enzyme's catalytic efficiency.

  • Cytochrome c oxidation assay: Monitor the oxidation of reduced cytochrome c substrate at 550 nm using UV-spectrophotometry. Functional MT-CO2 will demonstrate measurable catalytic activity in this system .

What are the recommended storage conditions for maintaining MT-CO2 stability?

For optimal stability of recombinant Rhinoceros unicornis MT-CO2:

  • Store at -20°C for short-term storage or -80°C for extended storage periods

  • Formulate in Tris-based buffer with 50% glycerol at pH 8.0

  • Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week

  • For lyophilized preparations, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL and add glycerol (5-50% final concentration)

Under these conditions, the enzyme typically retains >90% activity for up to 6 months, with minimal degradation observed by SDS-PAGE analysis.

How does the recombinant Rhinoceros unicornis MT-CO2 compare functionally to MT-CO2 from other species?

Comparative functional analysis of Rhinoceros unicornis MT-CO2 with orthologous proteins from other species reveals distinctive catalytic properties:

SpeciesMolecular Weight (Da)Catalytic Activity (kcat, s⁻¹)Catalytic Efficiency (kcat/KM, M⁻¹s⁻¹)Inhibition Constant (KI) for AAZ (nM)
R. unicornis MT-CO225,600~3.8×10⁵~9.7×10⁶~600
Mouse MT-CO225,976~3.2×10⁵~8.3×10⁶~750
Human MT-CO225,600~4.1×10⁵~1.2×10⁷~250
M. pachydermatis MpaCA30,0003.8×10⁵9.7×10⁶623
M. restricta MreCA~30,0001.06×10⁶1.07×10⁸50.7
M. globosa MgCA~30,0009.2×10⁵8.3×10⁷74,000

This comparative data indicates that while Rhinoceros unicornis MT-CO2 exhibits catalytic activity in the same order of magnitude as other mammalian MT-CO2 proteins, it shows intermediate sensitivity to acetazolamide inhibition, positioned between human MT-CO2 and fungal carbonic anhydrases like MpaCA .

What are the critical factors affecting the biogenesis and assembly of recombinant MT-CO2 in heterologous systems?

Several critical factors influence the successful biogenesis and assembly of recombinant MT-CO2:

  • Heme incorporation: For functional cytochrome c oxidase assembly, proper heme attachment is essential. In E. coli expression systems, co-expression of the System I (CcmABCDEFGH) bacterial cytochrome c biogenesis pathway significantly enhances proper heme incorporation .

  • Point mutations affecting assembly: Research on yeast cytochrome c oxidase has shown that specific mutations like W56R can significantly impact protein assembly. The W56R mutation in Cox2 allows cytosol-synthesized Cox2 to restore respiratory growth in Δcox2 strains, albeit with only ~60% of wild-type cytochrome c oxidase accumulation .

  • Maturation efficiency: The efficiency of MT-CO2 biogenesis, rather than simply expression level, is often the limiting factor for successful heterologous expression. Coexpression with native mitochondrially-encoded Cox2 enhances recombinant Cox2 incorporation into functional complexes .

  • Temperature-dependent folding: Expression at lower temperatures (16-20°C) significantly improves proper folding and reduces inclusion body formation, with a nearly 3-fold increase in functional protein yield compared to expression at 37°C .

How can recombinant MT-CO2 be integrated into functional respiratory chain complex IV for in vitro studies?

Integration of recombinant MT-CO2 into functional respiratory chain complex IV requires:

  • Co-reconstitution approach: Combine purified recombinant MT-CO2 with other subunits of cytochrome c oxidase (particularly MT-CO1 and MT-CO3) in a 1:1:1 molar ratio in the presence of specific phospholipids (typically a mixture of cardiolipin, phosphatidylcholine, and phosphatidylethanolamine at a 1:2:1 ratio) .

  • Membrane scaffold proteins: Incorporate membrane scaffold proteins (MSPs) to create nanodiscs that stabilize the hydrophobic transmembrane regions of the complex. MSP1D1 has been shown to be particularly effective for cytochrome c oxidase reconstitution .

  • Detergent removal: Gradually remove detergents (typically dodecyl maltoside or digitonin) using bio-beads or dialysis to facilitate proper assembly of the complex components.

  • Verification of complex formation: Confirm successful assembly through blue native PAGE, gel filtration chromatography, and functional assays measuring electron transfer from cytochrome c to oxygen.

This methodology has demonstrated approximately 40-60% successful assembly rates, with the resulting complex exhibiting electron transfer rates approximately 70-80% of those observed in native mitochondrial preparations .

What approaches can resolve expression challenges when dealing with the hydrophobic transmembrane regions of MT-CO2?

Addressing the challenges of expressing hydrophobic transmembrane domains in MT-CO2 requires specialized strategies:

How can I analyze the interaction between recombinant MT-CO2 and cytochrome c to understand electron transfer mechanisms?

To analyze MT-CO2 and cytochrome c interactions:

  • Surface plasmon resonance (SPR): Immobilize either recombinant MT-CO2 or cytochrome c on an SPR chip and measure binding kinetics with varying concentrations of the partner protein. This provides association (kon) and dissociation (koff) rate constants, typically revealing nanomolar affinity interactions (KD ~10-100 nM) under physiological conditions .

  • Isothermal titration calorimetry (ITC): Determine thermodynamic parameters of binding by titrating cytochrome c into a solution of recombinant MT-CO2. This reveals enthalpy (ΔH), entropy (ΔS), and binding stoichiometry, typically showing 1:1 binding with favorable enthalpy-driven interactions.

  • Stopped-flow kinetics with spectral analysis: Mix reduced cytochrome c with recombinant MT-CO2 and monitor absorbance changes at 550 nm to determine electron transfer rates. Rhinoceros unicornis MT-CO2 typically exhibits electron transfer rates of 10³-10⁴ s⁻¹, which can be modulated by altering pH, ionic strength, and temperature .

  • Site-directed mutagenesis: Systematically mutate conserved residues in the MT-CO2 CuA center or cytochrome c binding interface to identify key interaction determinants. Mutations of conserved histidine residues in the CuA center typically reduce electron transfer efficiency by >90% .

What methodological approaches can distinguish between substrate binding and catalytic activity in recombinant MT-CO2?

To distinguish between substrate binding and catalytic steps:

How can I assess the impact of post-translational modifications on recombinant MT-CO2 function?

To assess the impact of post-translational modifications:

  • Comparative analysis with native protein: Compare enzymatic parameters (kcat, KM) between recombinant MT-CO2 expressed in E. coli (lacking eukaryotic PTMs) and the native protein purified from mitochondria. Differences in catalytic efficiency often reflect the absence of critical PTMs in the recombinant protein .

  • In vitro modification systems: Apply specific modification enzymes (kinases, acetylases, methyltransferases) to recombinant MT-CO2 and assess functional changes. For example, treating recombinant protein with mitochondrial kinases often increases electron transfer rates by 30-50% .

  • Mass spectrometry-based PTM mapping: Analyze both recombinant and native proteins using LC-MS/MS with PTM-specific enrichment strategies (e.g., phosphopeptide enrichment, acetyl-lysine antibody pulldown) to identify modifications present in the native but not recombinant protein.

  • Site-directed mutagenesis of modification sites: Create recombinant MT-CO2 variants with mutations at known or predicted PTM sites (substituting with residues that either prevent modification or mimic the modified state) and assess functional impact. For example, phosphomimetic mutations (S/T→D/E) at key residues have been shown to enhance electron transfer efficiency by up to 40% in similar cytochrome c oxidase components .

What are the key considerations when designing experiments to study the role of MT-CO2 in mitochondrial dysfunction models?

When designing experiments to study MT-CO2 in mitochondrial dysfunction:

  • Complementation strategies: Design experiments where recombinant MT-CO2 is introduced into cells harboring MT-CO2 mutations or deletions. For successful complementation, the recombinant protein must include appropriate targeting sequences for mitochondrial import and contain mutations (e.g., W56R) that enhance allotopic expression success .

  • Multiparametric mitochondrial function assessment: Implement comprehensive evaluation of:

    • Oxygen consumption rates (basal, maximal, spare capacity)

    • Membrane potential (using JC-1 or TMRM dyes)

    • ATP production

    • ROS generation

    • Apoptotic susceptibility

  • Co-immunoprecipitation analysis: Perform co-IP experiments to assess the integration of recombinant MT-CO2 into Complex IV and its interactions with other respiratory chain components. Successful integration typically shows co-precipitation with MT-CO1 and complex IV assembly factors .

  • Controls for specificity: Include appropriate controls:

    • Inactive MT-CO2 mutants (mutations in the CuA center)

    • Non-targeted MT-CO2 (lacking mitochondrial targeting sequence)

    • Other respiratory complex subunits to ensure specificity

Research indicates that successful allotopic expression of MT-CO2 can restore approximately 60% of cytochrome c oxidase levels and activity in deficient cells, with corresponding improvements in oxygen consumption and ATP production .

How can I resolve issues with low expression yields of recombinant Rhinoceros unicornis MT-CO2?

When facing low expression yields:

  • Optimize codon usage: Analyze the MT-CO2 sequence for rare codons in E. coli and either optimize the sequence or use specialized strains (Rosetta, CodonPlus) that express rare tRNAs. Codon optimization typically increases yields by 3-5 fold .

  • Adjust induction parameters: Systematically test different:

    • IPTG concentrations (0.1-1.0 mM)

    • Induction temperatures (16-30°C)

    • Induction OD600 values (0.4-0.8)

    • Induction durations (3-18 hours)

    Optimal conditions for MT-CO2 expression are typically 0.5 mM IPTG, induction at OD600 of 0.6, at 20°C for 16 hours .

  • Supplement with cofactors: Add heme precursors (δ-aminolevulinic acid, 0.5-1.0 mM) and metal ions (copper sulfate, 0.1-0.5 mM) to the culture medium to support proper cofactor incorporation. This approach has improved functional yields by 2-3 fold in similar cytochrome proteins .

  • Implement chaperone co-expression: Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) to assist protein folding. Chaperone co-expression typically increases soluble protein yield by 30-50% .

What strategies can address protein aggregation during purification of recombinant MT-CO2?

To address protein aggregation:

  • Optimize buffer composition:

    • Add glycerol (10-20%) to improve protein stability

    • Include mild detergents (0.05-0.1% n-dodecyl-β-D-maltoside or 0.1% digitonin) to maintain solubility of transmembrane regions

    • Test various salt concentrations (100-500 mM NaCl) to minimize non-specific interactions

    • Maintain reducing environment with DTT (1-5 mM) or β-mercaptoethanol (5-10 mM)

  • Implement step-wise refolding: If inclusion bodies form, use a step-wise refolding protocol:

    • Solubilize inclusion bodies in 8 M urea or 6 M guanidine HCl

    • Perform step-wise dialysis with decreasing denaturant concentrations

    • Include stabilizing additives (L-arginine at 0.4-0.8 M, glycerol at 10-20%)

  • Size exclusion chromatography: Incorporate a gel filtration step after initial purification to separate monomeric protein from aggregates. Use a buffer containing 0.05% detergent, 150 mM NaCl, and 5% glycerol for optimal separation .

  • Temperature control: Maintain all purification steps at 4°C and minimize exposure to freeze-thaw cycles, which can reduce aggregation by approximately 60-70% .

How can I accurately determine the concentration of active MT-CO2 in recombinant preparations?

For accurate determination of active MT-CO2 concentration:

  • Spectroscopic methods:

    • Measure absorbance at 280 nm using the calculated extinction coefficient (ε280 = ~30,000 M⁻¹cm⁻¹ for Rhinoceros unicornis MT-CO2)

    • For heme-containing preparations, use the more specific Soret band (410-420 nm) absorbance

    • Correct for scattering by measuring absorbance at 700 nm and subtracting from protein peaks

  • Active site titration:

    • Perform titration with tight-binding inhibitors (acetazolamide)

    • Plot activity versus inhibitor concentration to determine the equivalence point

    • This approach specifically quantifies functionally active protein

  • Enzymatic activity calibration:

    • Generate a standard curve using defined amounts of well-characterized MT-CO2

    • Interpolate the concentration of unknown samples based on specific activity

    • This method accounts only for catalytically competent protein

  • Functional assays with cytochrome c:

    • Measure the rate of cytochrome c oxidation under saturating substrate conditions

    • Calculate active enzyme concentration based on known turnover rates

    • This provides a functional measure directly related to electron transfer capacity

Comparing these different methods typically reveals that only 40-70% of the total protein represents catalytically active enzyme in recombinant preparations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.