Recombinant Rhinoceros unicornis NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare your order accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life of our products depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Rhinoceros unicornis (Greater Indian rhinoceros)
Target Names
Target Protein Sequence
MSLIHINIFLAFTVSLMGLLMYRSHLMSSLLCLEGMMLSLFIMATMMVLNSHFTLAIMMP IILLVFAACEAALGLSLLVMISNTYGMDYVQNLNLLQC
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its role in mitochondrial function?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a protein encoded by the mitochondrial genome that functions as an essential component of Complex I in the electron transport chain. This protein plays a critical role in oxidative phosphorylation, the process through which mitochondria convert energy from food into ATP, the cell's primary energy currency .

The MT-ND4L protein contributes to the first step in the electron transport process, facilitating the transfer of electrons from NADH to ubiquinone. This electron transfer generates an electrochemical gradient across the inner mitochondrial membrane, creating a difference in electrical charge that provides the energy necessary for ATP production . As part of Complex I, MT-ND4L helps create this unequal electrical charge through the step-by-step movement of electrons, which ultimately powers cellular energy production.

In functional studies, researchers have observed that disruption of MT-ND4L significantly impairs Complex I assembly and activity, demonstrating its essential role in mitochondrial energy metabolism and cellular bioenergetics .

How is Recombinant Rhinoceros unicornis MT-ND4L produced for research applications?

The production of Recombinant Rhinoceros unicornis MT-ND4L typically employs specialized expression systems to overcome the challenges associated with membrane protein production. Based on similar mitochondrial proteins, MT-ND4L can be expressed using either E. coli bacterial systems (similar to MT-ND6) or baculovirus expression systems (as used for MT-ND3) .

The methodology for recombinant production follows these general steps:

  • Gene isolation and vector construction: The MT-ND4L sequence is isolated from Rhinoceros unicornis mitochondrial DNA and cloned into an appropriate expression vector.

  • Expression system transformation: The expression vector is introduced into the chosen host system (bacterial, insect, or mammalian cells).

  • Protein expression induction: Culture conditions are optimized to maximize protein yield while maintaining proper folding.

  • Cell lysis and membrane fraction isolation: Specialized buffers preserve protein structure during extraction.

  • Protein purification: Affinity chromatography and additional purification steps achieve >85% purity, typically confirmed by SDS-PAGE analysis .

  • Quality control: Testing for structural integrity and functional activity ensures research-grade quality.

Expression system selection depends on specific research requirements, with E. coli systems offering cost-effectiveness and higher yields, while baculovirus systems may provide better post-translational modifications and protein folding for this membrane-embedded protein.

What are the optimal storage conditions and handling protocols for MT-ND4L protein preparations?

Maintaining the stability and activity of Recombinant MT-ND4L requires careful attention to storage conditions and handling procedures. Based on established protocols for similar mitochondrial proteins, the following recommendations apply:

Storage ParameterRecommended ConditionNotes
Long-term storage temperature-20°C to -80°CLower temperatures (-80°C) preferred for extended storage
Shelf life (liquid form)6 months at -20°C to -80°CDependent on buffer composition and freeze-thaw cycles
Shelf life (lyophilized form)12 months at -20°C to -80°CProvides greater stability than liquid preparations
Working aliquots4°C for up to one weekMinimizes freeze-thaw degradation
Reconstitution mediumDeionized sterile waterTarget concentration: 0.1-1.0 mg/mL
Glycerol content5-50% (final concentration)50% is typically recommended as standard

Critical handling considerations include:

  • Avoiding repeated freeze-thaw cycles, which significantly degrade protein quality

  • Brief centrifugation of vials prior to opening to collect contents

  • Aliquoting reconstituted protein to minimize subsequent freeze-thaw events

  • When preparing dilutions, using appropriate buffers that maintain protein stability

These storage protocols are essential for preserving MT-ND4L structural integrity and functional activity, particularly given the delicate nature of membrane proteins and their susceptibility to denaturation during handling and storage.

How does MT-ND4L contribute to electron transport chain function?

MT-ND4L serves multiple critical functions within Complex I of the electron transport chain, playing both structural and functional roles in oxidative phosphorylation:

  • Structural contribution: MT-ND4L forms part of the membrane-embedded arm of Complex I, providing essential structural elements for the assembly and stability of this 45+ subunit complex . Its correct incorporation is necessary for the proper assembly of other subunits and the formation of a functional complex.

  • Electron transfer pathway: While not directly involved in NADH binding, MT-ND4L contributes to the electron transfer pathway within Complex I. The protein helps facilitate the movement of electrons from NADH through iron-sulfur clusters and ultimately to ubiquinone .

  • Proton translocation: The electron transfer through Complex I drives conformational changes that are coupled to proton pumping across the inner mitochondrial membrane. MT-ND4L participates in this process, contributing to the generation of the proton gradient that ultimately powers ATP synthesis .

  • Complex I integrity: Research using gene editing technologies has demonstrated that MT-ND4L knockout significantly reduces Complex I levels and basal oxygen consumption rates, confirming its essential role in maintaining complex function .

How can gene editing technologies be applied to study MT-ND4L function?

The development of mitochondrial DNA editing technologies, particularly DddA-derived cytosine base editors (DdCBE), has revolutionized functional studies of MT-ND4L. These techniques allow precise genetic manipulation that was previously impossible due to the challenges of mitochondrial genome editing . For researchers studying MT-ND4L, the methodological approaches include:

  • Precision knockout strategy: DdCBE can introduce targeted premature stop codons in MT-ND4L. For example, researchers have successfully modified the coding sequence for Val90 and Gln91 (GTC CAA) to create a premature stop codon (GTT-TAA) by deaminating two consecutive cytosines on the coding strand . This creates a truncation mutation that effectively eliminates protein function.

  • Experimental workflow for MT-ND4L editing:

    StepMethodologyTechnical Considerations
    DesignCreate paired TALE domains targeting MT-ND4LOptimize for specificity and minimal off-target effects
    ConstructionAssemble DdCBE vectors with optimized split orientation1333 DddA tox split orientation is preferred for efficiency
    DeliveryTransfect cells and select via FACSMonitor expression of fluorescent markers
    RecoveryAllow 7-14 days for editing to occurMaintain selective pressure if needed
    AssessmentMeasure heteroplasmy via sequencingPCR amplification followed by sequencing or fragment analysis
    EnrichmentPerform sequential rounds of transfectionIncreases editing efficiency to near-homoplasmy
    ValidationConfirm knockout via functional assaysComplex I activity, respiration measurements
  • Heteroplasmy manipulation: Through controlled transfection conditions and sequential rounds of treatment, researchers can achieve desired heteroplasmy levels ranging from low percentages to near-homoplasmy, allowing the study of threshold effects .

  • Functional impact assessment: Following MT-ND4L modification, researchers can measure:

    • Complex I assembly and activity

    • Oxygen consumption rates (significantly reduced in knockouts)

    • Mitochondrial membrane potential

    • ATP production

    • Reactive oxygen species generation

    • Cell viability and growth characteristics

This technology has demonstrated that MT-ND4L knockout significantly impairs mitochondrial function, confirming its essential role in oxidative phosphorylation and providing a powerful tool for investigating mitochondrial gene function in unprecedented detail .

What experimental approaches can effectively measure electron transport chain activity following MT-ND4L modification?

Following genetic or biochemical modification of MT-ND4L, comprehensive assessment of electron transport chain function requires multiple complementary methodologies:

  • Respirometry and oxygen consumption analysis:

    • High-resolution respirometry (Oroboros O2k or Seahorse XF analyzers) enables precise measurement of oxygen consumption rates

    • Protocol involves measuring:

      • Basal respiration (routine cellular oxygen consumption)

      • Maximal respiration (after FCCP addition)

      • Complex I-specific respiration (using glutamate/malate or pyruvate as substrates)

      • Reserve capacity (difference between maximal and basal respiration)

    • Studies show significantly reduced oxygen consumption in MT-ND4L knockout cells

  • Enzyme activity assays:

    • Spectrophotometric measurement of NADH oxidation (340nm absorbance decrease)

    • NADH:ubiquinone oxidoreductase activity with artificial electron acceptors

    • Blue native PAGE followed by in-gel activity assays to assess Complex I function

    • Comparative analysis between wild-type and MT-ND4L-modified samples

  • Membrane potential and proton gradient measurements:

    • Fluorescent potentiometric dyes (TMRM, JC-1) quantify mitochondrial membrane potential

    • Flow cytometry or microscopy-based analysis provides population and single-cell assessments

    • Time-resolved measurements following substrate addition reveal dynamic responses

  • Comprehensive analytical workflow:

    Analysis StageMethodologyExpected Outcomes in MT-ND4L Dysfunction
    Genotypic verificationPCR and sequencingConfirmation of intended MT-ND4L modification
    Global respirationHigh-resolution respirometryReduced oxygen consumption, particularly in Complex I-dependent substrates
    Complex I activitySpectrophotometric assaysDecreased NADH oxidation rate
    Supercomplex assemblyBlue native PAGEAltered Complex I integration into supercomplexes
    Membrane potentialTMRM fluorescenceDiminished Δψm compared to wild-type
    ATP productionLuciferase-based assaysReduced ATP synthesis capacity
    ROS productionMitoSOX or similar probesPotentially increased ROS generation
  • Data interpretation considerations:

    • Compare results across multiple methodologies to build comprehensive understanding

    • Normalize to appropriate controls (cell number, protein content, mitochondrial mass)

    • Consider compensatory mechanisms that may mask primary defects

    • Evaluate time-dependent changes in mitochondrial function following MT-ND4L modification

This multi-parameter approach provides robust assessment of the functional consequences of MT-ND4L modification, revealing both direct effects on Complex I and broader impacts on mitochondrial energy metabolism .

What are the implications of MT-ND4L mutations for mitochondrial diseases?

Mutations in MT-ND4L have significant implications for human disease, particularly mitochondrial disorders characterized by Complex I deficiency. Understanding these relationships informs both basic research and potential therapeutic approaches:

  • Leber hereditary optic neuropathy (LHON):

    • The T10663C (Val65Ala) mutation in MT-ND4L has been identified in several families with LHON, a disorder characterized by rapid, painless vision loss

    • This mutation changes a conserved valine residue to alanine at position 65, potentially altering protein function

    • The precise mechanism linking this mutation to optic nerve degeneration remains under investigation

  • Complex I deficiency syndrome:

    • MT-ND4L mutations can contribute to broader Complex I deficiency, which manifests differently depending on the tissues affected

    • Clinical manifestations may include:

      • Encephalopathy (brain dysfunction)

      • Cardiomyopathy (heart muscle disease)

      • Myopathy (skeletal muscle weakness)

      • Lactic acidosis (build-up of lactic acid in the body)

  • Research approaches for studying MT-ND4L-related diseases:

    ApproachMethodologyResearch Applications
    Patient-derived modelsFibroblasts or iPSCs from affected individualsDirect study of disease-causing mutations
    Cybrid modelsTransfer of patient mitochondria into ρ0 cellsIsolation of mtDNA effects from nuclear background
    Gene editing modelsMitoKO DdCBE technologiesIntroduction of specific mutations for mechanistic studies
    Biochemical characterizationSpectrophotometric and polarographic assaysQuantification of enzymatic defects
    Structural biologyCryo-EM studies of patient-derived Complex IVisualization of structural perturbations
  • Heteroplasmy threshold effects:

    • MT-ND4L mutations typically exhibit threshold effects where symptoms manifest when mutant load exceeds 60-80%

    • Tissue-specific thresholds may vary based on metabolic demand and mitochondrial content

    • Longitudinal studies show mutation load can change over time, affecting disease progression

  • Therapeutic implications:

    • Understanding MT-ND4L pathology guides development of targeted therapies

    • Potential approaches include:

      • Heteroplasmy shifting strategies to reduce mutant load

      • Gene therapy to introduce functional MT-ND4L

      • Bypass approaches that circumvent Complex I deficiency

      • Metabolic interventions to support cellular bioenergetics

The research into MT-ND4L mutations provides fundamental insights into mitochondrial disease mechanisms while identifying potential therapeutic targets for disorders currently lacking effective treatments .

How does the structure and function of MT-ND4L differ between species?

Comparative analysis of MT-ND4L across species reveals both conserved elements essential for function and structural variations that may reflect evolutionary adaptations:

  • Sequence conservation patterns:

    • Core functional domains show high conservation across mammalian species

    • Transmembrane domains exhibit greater conservation than loop regions

    • Rhinoceros unicornis MT-ND4L (98 amino acids) shares significant homology with human and other mammalian orthologues

    • Catalytic residues involved in electron transport maintain strict conservation

  • Structural comparison:

    • MT-ND4L typically features 3-4 transmembrane helices across species

    • Hydrophobicity profiles remain similar despite sequence variations

    • Species-specific differences appear predominantly in non-catalytic regions

    • Post-translational modification sites may vary between species

  • Comparative sequence analysis of MT-ND4L across selected species:

    SpeciesSequence LengthSequence Identity vs Human*Key Structural Differences
    Rhinoceros unicornis98 aa~80-85%Variations in loop regions between transmembrane domains
    Homo sapiens98 aa100%Reference sequence
    Mus musculus98 aa~75-80%Minor variations in transmembrane domain composition
    Gallus gallus98 aa~65-70%More substantial differences in hydrophobic regions
    Xenopus laevis98 aa~55-60%Greater variation in N-terminal region

    *Approximate identity percentages based on typical conservation patterns

  • Functional implications:

    • Species-specific variations may reflect metabolic adaptations

    • Differences in thermal stability could relate to environmental adaptations

    • Altered protein-protein interaction surfaces might affect Complex I assembly

    • Conservation patterns highlight functionally critical residues

  • Research methodologies for cross-species comparison:

    • Multiple sequence alignment tools (CLUSTALW, MUSCLE)

    • Homology modeling based on available cryo-EM structures

    • Functional complementation studies (replacing MT-ND4L across species)

    • Evolutionary rate analysis to identify selectively constrained regions

This comparative approach provides insights into the structure-function relationship of MT-ND4L, revealing both universal aspects of mitochondrial energy production and species-specific adaptations that may reflect different metabolic requirements or environmental pressures .

What are the challenges in studying MT-ND4L interactions with other components of Complex I?

Investigating MT-ND4L's interactions within Complex I presents significant technical challenges requiring specialized approaches:

  • Membrane protein-specific challenges:

    • Extreme hydrophobicity complicates traditional interaction assays

    • Native conformation depends on lipid environment

    • Detergent solubilization may disrupt authentic interactions

    • Protein-protein interfaces often involve transmembrane domains

  • Complex I assembly dynamics:

    • The 45+ subunit complex assembles through specific sequential pathways

    • MT-ND4L may interact with different partners during assembly versus in mature complex

    • Assembly factors influence interaction networks but may be absent in reconstituted systems

    • Determining direct versus indirect interactions requires specialized techniques

  • Technical approaches for overcoming these challenges:

    ApproachMethodologyAdvantagesLimitations
    Chemical cross-linking with MSCapture interactions with bifunctional reagentsIdentifies interacting regionsLimited by cross-linker chemistry
    Proximity labelingBioID or APEX2 fusions to MT-ND4LWorks in living cellsRequires genetic modification
    Co-immunoprecipitationAntibody pulldown with detergent optimizationPreserves stronger interactionsMay lose transient interactions
    FRET/BRETFluorescent/bioluminescent protein fusionsMonitors interactions in real-timeSize of tags may perturb function
    Cryo-EMSingle particle analysis of intact Complex IProvides structural contextRequires highly pure samples
  • Experimental considerations:

    • Detergent selection critically affects interaction preservation

    • Lipid composition influences membrane protein associations

    • Temperature and buffer conditions must be carefully optimized

    • Control experiments must account for non-specific interactions

  • Data integration approach:

    • Combine multiple complementary methods

    • Correlate interaction data with functional measurements

    • Use structure-guided experimental design

    • Validate key interactions through mutagenesis studies

By addressing these methodological challenges, researchers can develop a comprehensive understanding of how MT-ND4L interacts with other Complex I components, providing insights into both assembly mechanisms and functional dynamics during electron transport .

What are the optimal protocols for isolating and purifying recombinant MT-ND4L?

Successful isolation and purification of recombinant MT-ND4L requires specialized protocols to address the challenges associated with membrane protein biochemistry:

  • Expression system selection and optimization:

    • E. coli systems: Higher yield but may require refolding procedures

    • Baculovirus systems: Better for membrane protein folding but lower yield

    • Fusion partners (MBP, SUMO, Trx) enhance solubility

    • Codon optimization improves expression efficiency

    • Induction conditions require careful optimization (temperature, inducer concentration)

  • Extraction and solubilization strategy:

    DetergentPropertiesRecommended ConcentrationApplications
    DDMMild, preserves function1-2% for extraction, 0.05-0.1% for purificationInitial extraction
    LMNGEnhanced stability0.5-1% for extraction, 0.01-0.05% for purificationLong-term stability
    DigitoninVery mild, preserves supercomplexes1-2% for extraction, 0.1-0.5% for purificationStructural studies
    SMALPsDetergent-free, preserves lipid environment2.5% SMA copolymerNative environment preservation
  • Purification workflow:

    • Initial capture: Affinity chromatography (typically His-tag based)

    • Intermediate purification: Ion exchange chromatography

    • Final polishing: Size exclusion chromatography

    • Quality control: SDS-PAGE analysis to confirm >85% purity

  • Buffer optimization for stability:

    • pH range: Typically 7.2-8.0

    • Salt concentration: 150-300 mM NaCl

    • Glycerol content: 5-50% (final concentration)

    • Reducing agents: DTT or β-mercaptoethanol to prevent oxidation

    • Protease inhibitors: Complete cocktail to prevent degradation

  • Storage considerations:

    • Temperature: -20°C to -80°C for long-term storage

    • Aliquoting: Minimize freeze-thaw cycles

    • Shelf life: 6 months for liquid preparations, 12 months for lyophilized form

    • Working solution: Store at 4°C for up to one week

  • Reconstitution methodology:

    • Liposome preparation: Defined lipid composition reflecting mitochondrial inner membrane

    • Detergent removal techniques: Dialysis, Bio-Beads, or cyclodextrin

    • Protein:lipid ratio optimization: Typically 1:100 to 1:1000 (w/w)

    • Functional validation: Spectroscopic or biochemical assays

This comprehensive approach addresses the specific challenges associated with MT-ND4L as a hydrophobic membrane protein, providing researchers with purified material suitable for structural, functional, and interaction studies .

How can researchers design experiments to study post-translational modifications of MT-ND4L?

Post-translational modifications (PTMs) of MT-ND4L can significantly impact its function and interactions. Designing experiments to study these modifications requires specialized approaches:

By implementing these methodological approaches, researchers can characterize the PTM landscape of MT-ND4L and determine how these modifications regulate mitochondrial function under different physiological and pathological conditions, potentially revealing novel regulatory mechanisms and therapeutic targets.

What methodologies can be used to study the role of MT-ND4L in Complex I assembly?

Investigating MT-ND4L's role in Complex I assembly requires specialized techniques to track the sequential incorporation of subunits and formation of functional complexes:

  • Time-course assembly tracking:

    • Pulse-chase labeling with radioactive or stable isotopes

    • Temporal sampling followed by immunoprecipitation

    • Blue native PAGE separation of assembly intermediates

    • Mass spectrometry identification of interaction partners at each stage

  • Genetic manipulation approaches:

    ApproachMethodologyResearch Applications
    MT-ND4L knockoutsMitoKO using DdCBE technologyDetermine assembly defects in absence of MT-ND4L
    Conditional expressionInducible systemsMonitor assembly process in real-time
    Tagged versionsEpitope or fluorescent tagsTrack localization and interactions
    Mutational analysisStructure-guided mutationsIdentify critical assembly interfaces
  • Structural biology techniques:

    • Cryo-electron microscopy of assembly intermediates

    • Cross-linking mass spectrometry to identify spatial relationships

    • Hydrogen-deuterium exchange to monitor conformational changes

    • Single-particle analysis of subcomplexes

  • Biochemical characterization:

    • Density gradient centrifugation to separate assembly intermediates

    • Size exclusion chromatography to analyze complex formation

    • Activity assays to correlate assembly with function

    • Import assays to monitor incorporation kinetics

  • Visualization approaches:

    • Fluorescence microscopy with tagged components

    • Super-resolution techniques (STORM, PALM) for detailed spatial information

    • FRET/BRET systems to monitor protein proximity during assembly

    • Live-cell imaging to track assembly dynamics

  • Data analysis framework:

    • Integration of temporal and spatial information

    • Correlation of structural data with functional measurements

    • Network analysis of protein-protein interactions

    • Computational modeling of assembly pathways

Research using these methods has demonstrated that MT-ND4L plays a critical role in Complex I assembly, with knockout studies showing significantly reduced levels of fully assembled complex . This indicates that MT-ND4L likely serves as a nucleation point or stabilizing element during the complex assembly process, making it essential for mitochondrial energy production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.