Recombinant Rhinolophus darlingi Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Please contact us in advance for dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, and this can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Rhinolophus darlingi (Darling's horseshoe bat)
Target Names
Target Protein Sequence
MAHPFQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLLLTTSLTHTSTMDAQE VETIWTILPAIILIMIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS YMIPTSDLKPGELRLLEVDNRVVLPMEMTIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QTTLLSNRPGLYYGQCSEICGSNHSFMPIVLELVPLKHFEKWSSSMV
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives both transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) consisting of heme A3 and CuB. The BNC then reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Rhinolophus darlingi Cytochrome c oxidase subunit 2 (MT-CO2)?

MT-CO2 is a mitochondrial genome-encoded protein essential for the respiratory chain complex IV. It functions as a subunit of cytochrome c oxidase, the terminal enzyme of the mitochondrial electron transport chain. The recombinant form of this protein from Rhinolophus darlingi (Darling's horseshoe bat) consists of 227 amino acids and has the UniProt accession number Q37643 . MT-CO2 is also known by alternative names including Cytochrome c oxidase polypeptide II, and its gene can be referenced as MT-CO2, COII, COXII, or MTCO2 . Recent research indicates that MT-CO2 plays critical roles beyond its canonical function in oxidative phosphorylation, including involvement in cellular adaptation to metabolic stress, particularly under glucose-deprived conditions .

How does MT-CO2 function in cellular metabolism?

MT-CO2 functions primarily as part of cytochrome c oxidase (Complex IV) in the mitochondrial electron transport chain, catalyzing the transfer of electrons from cytochrome c to molecular oxygen, which is reduced to water. This process is coupled to proton pumping across the inner mitochondrial membrane, contributing to the electrochemical gradient used for ATP synthesis. Recent studies have revealed additional metabolic functions of MT-CO2, particularly under glucose deprivation conditions. Research demonstrates that glucose deprivation leads to significant upregulation of MT-CO2 expression .

The upregulated MT-CO2 increases flavin adenosine dinucleotide (FAD) levels, which activates lysine-specific demethylase 1 (LSD1). This epigenetic regulator then upregulates JUN transcription, promoting glutaminase-1 (GLS1) expression and enhancing glutaminolysis. This metabolic reprogramming allows cells to utilize glutamine as an alternative energy source when glucose is limited, which is particularly relevant in tumor microenvironments . This mechanism represents a critical adaptation that enables cells to survive under metabolic stress conditions by switching energy sources from glycolysis to glutaminolysis.

What is the evolutionary significance of MT-CO2 in horseshoe bats?

MT-CO2 has proven to be an informative genetic marker for evolutionary studies of horseshoe bats (Rhinolophidae: Rhinolophus). Phylogenetic analyses using mitochondrial genes, including cytochrome c oxidase II, have contributed significantly to understanding the diversification mechanisms and evolutionary relationships among bat species . Horseshoe bats have undergone complex evolutionary diversification patterns, with two major dispersal events from Asia into Southeast Asia and Africa playing key roles in shaping their current diversity .

Comparative analyses of MT-CO2 sequences across different bat species have revealed patterns of genetic divergence that align with morphological and ecological adaptations. These molecular data have been used to construct phylogenetic trees that indicate a close relationship between Chiroptera (bats) and Eulipotyphla (core insectivores) within the mammalian evolutionary tree . The conservation of functional domains within MT-CO2, alongside lineage-specific variations, provides insights into both the selective pressures and adaptive evolution of respiratory metabolism in bats, which may relate to their high energy demands associated with flight and echolocation.

How can MT-CO2 be utilized in phylogenetic studies of Chiroptera?

MT-CO2 sequences offer valuable data for resolving phylogenetic relationships among bat species due to their relatively conservative evolutionary rate and functional importance. When utilizing MT-CO2 for phylogenetic studies, researchers should implement the following methodological approach: First, extract total DNA from tissue samples, followed by PCR amplification of the MT-CO2 gene using specific primers designed for Chiroptera. After sequencing, conduct sequence alignment using software such as MUSCLE or CLUSTAL, with manual refinement to ensure correct homology assessment .

For phylogenetic reconstruction, multiple methods should be employed, including Maximum Likelihood (ML), Bayesian Inference, and Maximum Parsimony. When applying these methods, researchers should consider using appropriate evolutionary models such as the HKY model with gamma distribution to account for rate heterogeneity across sites. Studies have employed ML estimates of transition/transversion rate ratios (approximately 4.1 for similar mitochondrial genes) and shape parameters (alpha ≈ 0.38 for COII) . Comparative analysis of resulting trees should evaluate log-likelihood values to determine the most statistically supported topology. This approach has been successful in confirming the relationship between Chiroptera and other mammalian orders, suggesting Tree-1 (((Primates, Fereuungulata), Chiroptera), (Eulipotyphla, Rodentia)) as the highest likelihood arrangement when analyzing total mitochondrial gene evidence .

What techniques are optimal for analyzing MT-CO2 expression in tissue samples?

Several complementary techniques can be employed for comprehensive analysis of MT-CO2 expression:

  • Quantitative RT-PCR (RT-qPCR): Design primers specific to Rhinolophus darlingi MT-CO2 mRNA, with validation using melt curve analysis to ensure specificity. Normalization should employ multiple reference genes (e.g., GAPDH, β-actin, and 18S rRNA) to account for tissue-specific variation in housekeeping gene expression. For accurate quantification, the 2^(-ΔΔCT) method with efficiency correction is recommended .

  • Western Blotting: Use antibodies with confirmed cross-reactivity to Rhinolophus MT-CO2, with appropriate positive controls (recombinant protein) and negative controls. When comparing expression levels across conditions, densitometric analysis normalized to mitochondrial loading controls (e.g., VDAC or COX IV) rather than whole-cell proteins provides more accurate results .

  • Immunohistochemistry: Optimize antigen retrieval methods (citrate buffer, pH 6.0 at 95°C for 20 minutes works well for many mitochondrial proteins) when analyzing fixed tissue samples. Counter-staining with mitochondrial markers (e.g., MitoTracker) can confirm subcellular localization.

  • Mass Spectrometry: For comprehensive proteomic analysis, employ targeted proteomics approaches such as Selected Reaction Monitoring (SRM) or Parallel Reaction Monitoring (PRM), which offer higher sensitivity for detecting low-abundance mitochondrial proteins. When analyzing MT-CO2, unique signature peptides should be identified that distinguish it from other closely related cytochrome oxidase subunits.

How does glucose deprivation affect MT-CO2 expression and function?

Glucose deprivation significantly upregulates MT-CO2 expression through dual mechanisms affecting both transcription and mRNA stability . At the transcriptional level, glucose deprivation activates Ras signaling pathways, which enhance MT-CO2 transcription. Concurrently, glucose deprivation inhibits IGF2BP3, an RNA-binding protein that normally targets MT-CO2 mRNA for degradation, thus increasing MT-CO2 mRNA stability .

The elevated levels of MT-CO2 protein trigger a metabolic cascade that facilitates cellular adaptation to glucose scarcity. Specifically, increased MT-CO2 raises cellular flavin adenosine dinucleotide (FAD) levels, which serves as a cofactor for lysine-specific demethylase 1 (LSD1) . This epigenetic modifier then upregulates JUN transcription, which subsequently promotes the expression of glutaminase-1 (GLS1). Enhanced GLS1 activity accelerates glutaminolysis, enabling cells to utilize glutamine as an alternative energy source when glucose is limited .

This metabolic adaptation is particularly significant in cancer cells, where MT-CO2 has been found to be indispensable for oncogenic Ras-induced glutaminolysis and tumor growth. Clinical relevance of this pathway is supported by the association between elevated MT-CO2 expression and poor prognosis in lung cancer patients . Experimental studies of this pathway should employ glucose-free media supplemented with dialyzed serum to eliminate trace glucose, coupled with isotope-labeled glutamine to trace metabolic flux through the TCA cycle and related pathways.

How to design experiments to study MT-CO2's role in cellular metabolism?

When designing experiments to investigate MT-CO2's metabolic functions, consider the following methodological approaches:

  • Gene Expression Modulation: Employ both loss-of-function and gain-of-function approaches. For knockdown, design siRNAs or shRNAs specific to Rhinolophus darlingi MT-CO2, with multiple constructs targeting different regions to confirm specificity. For overexpression, use expression vectors with appropriate mitochondrial targeting sequences to ensure proper subcellular localization .

  • Metabolic Flux Analysis: Utilize 13C-labeled glucose or glutamine combined with mass spectrometry to trace carbon flow through glycolysis, TCA cycle, and glutaminolysis pathways. This approach can quantitatively assess how MT-CO2 alterations affect specific metabolic branches .

  • Mitochondrial Function Assessment: Measure oxygen consumption rate (OCR) and extracellular acidification rate (ECAR) using platform technologies such as Seahorse XF Analyzer. These parameters should be measured under various conditions, including in the presence of specific inhibitors (oligomycin, FCCP, rotenone/antimycin A) to determine maximal respiratory capacity, ATP production, and spare respiratory capacity .

  • Nutrient Dependency Assays: Conduct cell viability assays under varying concentrations of glucose and glutamine to determine how MT-CO2 expression affects nutrient dependency. Include rescue experiments with metabolic intermediates (e.g., α-ketoglutarate, pyruvate) to identify specific metabolic bottlenecks.

ParameterControlMT-CO2 KnockdownMT-CO2 Overexpression
Basal OCR (pmol/min)100 ± 8.565.3 ± 7.2142.6 ± 12.3
Maximal OCR (pmol/min)187.4 ± 15.298.2 ± 10.5256.8 ± 18.7
Spare Respiratory Capacity (%)87.4 ± 6.732.9 ± 5.3114.2 ± 10.5
ATP Production (pmol/min)78.5 ± 5.345.7 ± 6.2112.3 ± 8.4
Glutamine Consumption (nmol/10^6 cells/hr)45.2 ± 3.828.6 ± 4.172.5 ± 5.7
Glutamate Production (nmol/10^6 cells/hr)32.7 ± 2.915.3 ± 3.259.8 ± 4.6

Table 1: Representative metabolic parameters in cells with modulated MT-CO2 expression levels (hypothetical data based on similar mitochondrial protein studies)

What controls should be included when studying MT-CO2 in different experimental contexts?

Robust experimental design for MT-CO2 research requires several specific controls:

  • Genetic Controls:

    • Scrambled siRNA/shRNA sequences with similar GC content for knockdown experiments

    • Empty vector controls matching the backbone of MT-CO2 expression constructs

    • Single-point mutants targeting critical functional residues as opposed to complete knockdown

    • Rescue experiments expressing siRNA-resistant MT-CO2 constructs in knockdown cells

  • Metabolic Controls:

    • Parallel experiments with inhibitors of specific metabolic pathways (e.g., BPTES for glutaminase inhibition)

    • Nutrient titration series (glucose, glutamine) to establish dose-dependent effects

    • Time-course analyses to distinguish primary from secondary metabolic adaptations

    • Internal metabolite standards for mass spectrometry quantification

  • Mitochondrial Controls:

    • Assessment of mitochondrial mass using fluorescent dyes (e.g., MitoTracker Green)

    • Quantification of mtDNA copy number relative to nuclear DNA

    • Measurement of other respiratory chain components to distinguish MT-CO2-specific effects

    • Evaluation of mitochondrial membrane potential using JC-1 or TMRE dyes

  • Cellular Context Controls:

    • Multiple cell lines or primary cultures to account for cell type-specific effects

    • Comparison between normal and stressed conditions (e.g., hypoxia, nutrient deprivation)

    • Inclusion of non-transformed control cells alongside cancer models

    • Matched normal tissue controls when analyzing clinical samples

How to address potential contamination issues when working with bat-derived proteins?

Working with proteins derived from bat species requires stringent contamination control measures:

  • Biosafety Considerations: Implement BSL-2 practices when working with bat-derived materials due to potential zoonotic pathogens. This includes working in certified biosafety cabinets, using appropriate personal protective equipment, and following institutional biosafety guidelines.

  • Source Authentication: Verify the species identity of the source material through DNA barcoding or PCR-based approaches targeting mitochondrial markers. For recombinant proteins, sequence confirmation is essential before and after expression to ensure integrity.

  • Contaminant Detection Protocols:

    • Employ PCR-based screening for common bat-associated viruses

    • Conduct regular mycoplasma testing on cell cultures

    • Implement metagenomic sequencing for comprehensive pathogen detection in source materials

    • Use mass spectrometry to confirm protein purity and identity

  • Production Considerations for Recombinant Protein:

    • Select expression systems (bacterial, insect, or mammalian) based on required post-translational modifications

    • Implement multiple orthogonal purification steps (e.g., affinity chromatography followed by size exclusion)

    • Validate protein purity using SDS-PAGE, Western blotting, and mass spectrometry

    • Test for endotoxin contamination, particularly when producing proteins for in vivo studies

What is known about MT-CO2's role in disease processes?

Recent research has revealed significant connections between MT-CO2 and various disease processes, particularly in cancer. Studies demonstrate that MT-CO2 plays a crucial role in metabolic reprogramming under glucose deprivation, a common condition in the tumor microenvironment . Increased MT-CO2 expression enables cancer cells to switch from glycolysis to glutaminolysis by activating a signaling cascade that ultimately upregulates glutaminase-1 (GLS1). This metabolic adaptation allows tumor cells to utilize glutamine as an alternative energy source, promoting survival and growth under nutrient-limited conditions .

Clinically, elevated MT-CO2 expression has been associated with poor prognosis in lung cancer patients, suggesting its potential value as a prognostic biomarker . Furthermore, MT-CO2 appears to be indispensable for oncogenic Ras-induced glutaminolysis and tumor growth, positioning it as a potential therapeutic target for Ras-driven cancers . This connection to the Ras pathway is particularly significant given that Ras mutations are among the most common oncogenic drivers in human cancers.

Beyond cancer, alterations in mitochondrial function involving cytochrome c oxidase components have been implicated in neurodegenerative disorders, though specific roles of MT-CO2 in these contexts require further investigation. The evolutionary conservation of MT-CO2 across species suggests that insights gained from studying this protein in model organisms, including bat species like Rhinolophus darlingi, may have broader implications for understanding human diseases associated with mitochondrial dysfunction.

How is MT-CO2 being studied in the context of comparative genomics?

MT-CO2 has proven valuable in comparative genomics studies, particularly for resolving phylogenetic relationships among mammalian orders. Research utilizing mitochondrial genes including cytochrome c oxidase subunit II has contributed to refining our understanding of evolutionary relationships between Chiroptera (bats) and other mammalian groups . Analysis of MT-CO2 sequences alongside other mitochondrial genes (cytochrome b, 12S rRNA, and 16S rRNA) has supported a close relationship between Chiroptera and Eulipotyphla (core Insectivora) .

Methodologically, these comparative genomic approaches employ sophisticated phylogenetic analysis techniques. Researchers have utilized maximum likelihood approaches with models accounting for transition/transversion biases and site-specific rate heterogeneity . Studies have specifically employed the HKY model with gamma distribution parameters optimized for mitochondrial genes, generating likelihood scores for alternative phylogenetic hypotheses .

These analyses contribute to broader questions about mammalian evolution and the adaptive significance of mitochondrial gene variations. The specific adaptations in respiratory chain components like MT-CO2 may relate to the metabolic demands associated with different mammalian lifestyles, such as the high energy requirements of flight in bats. Future comparative genomic studies could explore correlations between MT-CO2 sequence variations and metabolic capacity across species, potentially revealing patterns of adaptive evolution in response to ecological niches and energetic demands.

What emerging technologies are advancing MT-CO2 research?

Several cutting-edge technologies are revolutionizing MT-CO2 research:

How to interpret contradictory findings related to MT-CO2 function?

When encountering contradictory findings in MT-CO2 research, consider the following methodological approaches for reconciliation:

  • Examine Experimental Context Differences: Systematically compare experimental conditions across studies, including cell types, culture conditions, glucose/glutamine concentrations, and oxygen levels. MT-CO2 function is highly context-dependent, with potentially different roles under normoxic versus hypoxic conditions or in different cell lineages .

  • Evaluate Technical Approaches: Different methodologies may yield varying results. Compare protein detection methods (antibodies used, epitope accessibility), gene expression quantification approaches (primers, reference genes), and functional assays (oxygen consumption measurement techniques). Consider whether contradictions arise from method-specific biases rather than biological differences.

  • Assess Knockdown/Overexpression Efficiency: Partial versus complete knockdown of MT-CO2 may reveal different phenotypes due to compensatory mechanisms or threshold effects. Similarly, physiological versus non-physiological levels of overexpression may engage different downstream pathways.

  • Consider Post-Translational Modifications: Contradictory findings may result from different post-translational modification states of MT-CO2. Phosphorylation, acetylation, or oxidative modifications can significantly alter protein function without changing expression levels.

  • Design Definitive Experiments: To resolve contradictions, design experiments that specifically test competing hypotheses under identical conditions. Include appropriate controls for all variables that differ between contradictory studies. When possible, employ multiple complementary approaches to address the same question.

What are the key considerations when comparing MT-CO2 across different bat species?

Comparative analysis of MT-CO2 across bat species requires attention to several important factors:

  • Sequence Homology Assessment: When comparing MT-CO2 sequences, employ multiple sequence alignment tools with parameters optimized for mitochondrial genes. Pay special attention to conserved functional domains versus variable regions, which may reflect different selective pressures .

  • Evolutionary Rate Heterogeneity: Account for variable evolutionary rates across different bat lineages. Some horseshoe bat clades show accelerated evolution compared to others, potentially reflecting adaptation to different ecological niches .

  • Functional Context: Consider the broader metabolic and ecological context of different bat species. Flying bats have exceptionally high metabolic demands, but hibernating species show dramatic metabolic regulation, which may be reflected in MT-CO2 adaptations .

  • Phylogenetic Signal Versus Functional Convergence: Distinguish between sequence similarities due to common ancestry versus those resulting from convergent evolution under similar selective pressures. Statistical methods such as tests for selection (dN/dS ratios) can help identify positively selected sites that may indicate functional adaptation.

  • Geographic Distribution Effects: Consider how geographic isolation and dispersion events have shaped MT-CO2 evolution. Research indicates that two major dispersal events from Asia into Southeast Asia and Africa played key roles in shaping horseshoe bat diversity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.