Recombinant Rhinolophus ferrumequinum Dolichyldiphosphatase 1 (DOLPP1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us for preferential development.
Synonyms
DOLPP1; Dolichyldiphosphatase 1; Dolichyl pyrophosphate phosphatase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-238
Protein Length
full length protein
Species
Rhinolophus ferrumequinum (Greater horseshoe bat)
Target Names
DOLPP1
Target Protein Sequence
MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVVIIVGFVTLIIFKRELHTI SFLGGLVLNEGVNWLIKHVIQEPRPCGGPHPTVGTKYGMPSSHSQFMWFFSVYSFLFLYL RMHQTNNARFLDLLWRHVLSLGLLTAAFLVSYSRVYLLYHTWSQVLYGGVAGSLMAIAWF AFTQEVLTPLFPRIAAWPISEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ
Uniprot No.

Target Background

Function
Essential for efficient N-glycosylation, maintaining optimal dolichol-linked oligosaccharide levels. This enzyme exhibits high-rate hydrolysis of dolichyl pyrophosphate and significantly lower activity against dolichyl monophosphate. It does not act on phosphatidate.
Protein Families
Dolichyldiphosphatase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Dolichyldiphosphatase 1 (DOLPP1) and what is its primary function?

Dolichyldiphosphatase 1 (DOLPP1) is an enzyme (EC 3.6.1.43) that functions primarily in the dephosphorylation of dolichyl pyrophosphate (Dol-P-P). This critical activity enables the re-utilization of dolichyl pyrophosphate as a glycosyl carrier lipid by the oligosaccharyltransferase multisubunit complex in the endoplasmic reticulum (ER). The enzyme plays an essential role in the N-glycosylation pathway, which is fundamental to proper protein folding and function . In Rhinolophus ferrumequinum (Greater horseshoe bat), DOLPP1 has been characterized and encoded by a gene that produces a functional protein with conserved catalytic domains similar to those found in other mammalian species. Studies of this protein contribute to our understanding of glycosylation processes across diverse mammalian lineages.

What is the genomic organization of the DOLPP1 gene in mammals?

The DOLPP1 gene in mammals typically consists of 8 exons, as documented in human studies. In humans, it is located on chromosome 9q34.11 (genomic coordinates: 129081111..129090438 on NC_000009.12) . The gene undergoes alternative splicing, resulting in multiple transcript variants and protein isoforms with potentially diverse functional profiles. While the specific genomic organization in Rhinolophus ferrumequinum has not been completely characterized in the provided search results, comparative genomic analyses suggest conservation of the core exonic structure across mammalian species. Researchers investigating the bat DOLPP1 should consider designing primers that target conserved regions across species, particularly when establishing experimental protocols for gene expression studies.

How can I validate the expression of recombinant DOLPP1 in experimental systems?

Validation of recombinant DOLPP1 expression requires a multi-faceted approach combining molecular and biochemical techniques. A recommended protocol includes:

  • RT-qPCR analysis: Design primers specific to Rhinolophus ferrumequinum DOLPP1 transcripts, similar to the approach used in differential expression studies of bat liver genes . Use a reference gene such as β-actin as an internal control. The relative expression can be calculated using the 2^-ΔΔCT method, with results expressed as mean ± S.E.M.

  • Western blot analysis: Use commercially available antibodies that recognize conserved epitopes of DOLPP1, or develop custom antibodies against specific regions of the bat protein. A typical protocol would include SDS-PAGE separation, transfer to a PVDF membrane, and detection with appropriate primary and secondary antibodies.

  • Enzymatic activity assay: Validate functional expression by measuring the phosphatase activity against dolichyl pyrophosphate substrates. The activity can be quantified by measuring the release of inorganic phosphate or through coupled enzyme assays.

  • Mass spectrometry: Confirm the identity of the expressed protein through peptide mass fingerprinting or tandem mass spectrometry, comparing the results with the expected sequence (B2KI79) .

Each validation method provides complementary information about the expression level, size, functionality, and identity of the recombinant protein, ensuring comprehensive characterization before proceeding with further experiments.

What are the optimal conditions for expressing and purifying recombinant Rhinolophus ferrumequinum DOLPP1?

The optimal expression and purification of recombinant Rhinolophus ferrumequinum DOLPP1 involves careful consideration of expression systems, tags, and purification strategies:

Expression System Selection:

  • Prokaryotic systems (E. coli): Suitable for obtaining high yields, but may require refolding due to the presence of transmembrane domains in DOLPP1. BL21(DE3) or Rosetta strains are recommended for expression of eukaryotic proteins.

  • Eukaryotic systems: Insect cells (Sf9, Sf21) or mammalian cells (HEK293, CHO) provide better post-translational modifications and proper folding, which is crucial for membrane proteins like DOLPP1.

Expression Optimization Protocol:

  • For E. coli: Culture at 16-18°C after induction to enhance proper folding

  • For insect cells: Infection at MOI of 1-5, harvest 48-72 hours post-infection

  • For mammalian cells: Transfection followed by selection of stable cell lines

Purification Strategy:

  • Addition of a suitable tag (His6, GST, or FLAG) to facilitate purification while maintaining enzymatic activity

  • Solubilization with mild detergents (DDM, CHAPS) for membrane extraction

  • Affinity chromatography as the primary purification step

  • Size exclusion chromatography for final polishing

The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage to preserve enzymatic activity . Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week.

What experimental design approaches are best suited for studying DOLPP1 function?

When studying DOLPP1 function, a well-designed experimental approach using Design of Experiments (DOE) methodology is recommended. DOE allows for systematic investigation of multiple factors affecting DOLPP1 function simultaneously, rather than the less efficient "one factor at a time" (OFAT) approach .

Recommended Experimental Design Strategy:

  • Factorial Design: Implement a factorial experimental design to investigate multiple factors simultaneously, such as:

    • Temperature conditions (relevant for bat hibernation studies)

    • pH variations

    • Substrate concentrations

    • Cofactor requirements

    • Potential inhibitors

  • Key DOE Components to Include:

    • Blocking: When randomization of a factor is impossible or too costly, restrict randomization by carrying out all trials with one setting of the factor and then all trials with another setting .

    • Randomization: Randomize the order of experimental trials to eliminate effects of unknown or uncontrolled variables .

    • Replication: Include sufficient biological and technical replicates to ensure statistical validity.

  • Response Variables to Measure:

    • Enzymatic activity (primary outcome)

    • Protein stability

    • Binding affinity to substrates

    • Structural changes under different conditions

  • Analytical Methods:

    • Statistical analysis using ANOVA or regression models

    • Response surface methodology to optimize conditions

    • Principal component analysis for multivariate data interpretation

How does DOLPP1 from Rhinolophus ferrumequinum compare with DOLPP1 from other mammalian species?

Comparative analysis of DOLPP1 across mammalian species reveals important evolutionary patterns and functional conservation. While complete comparative data specifically for R. ferrumequinum DOLPP1 is limited in the provided search results, we can draw insights from available information:

Comparative Analysis Table of DOLPP1 Across Selected Mammalian Species:

SpeciesProtein LengthKey FeaturesSequence Identity to Human DOLPP1*Genomic Organization
Rhinolophus ferrumequinum (Greater horseshoe bat)238 aaTransmembrane domains, conserved catalytic sites~70-80% (estimated)Not fully characterized in search results
Elephantulus edwardii (Cape elephant shrew)Variable across isoformsMultiple isoforms (X1, X2)~60-70% (estimated)Multiple transcript variants (XM_006892470.1, XM_006892471.1)
Homo sapiens (Human)Variable across isoforms8 exons, alternative splicing100% (reference)Chromosome 9q34.11, 8 exons

*Sequence identity percentages are estimates based on typical conservation patterns among mammals, as exact values were not provided in the search results.

The conservation of DOLPP1 across diverse mammalian lineages (from bats to shrews to humans) suggests a fundamental role in cellular physiology. The presence of multiple isoforms in different species (as seen in the Elephantulus edwardii data ) indicates potential functional specialization or tissue-specific expression patterns that may have evolved to meet specific physiological demands.

Researchers studying R. ferrumequinum DOLPP1 should consider conducting formal phylogenetic analyses and structural modeling to better understand the evolutionary constraints on this enzyme and identify potentially unique adaptations in bat species, particularly those related to hibernation physiology.

What potential role does DOLPP1 play in the hibernation biology of Rhinolophus ferrumequinum?

While the search results don't specifically mention DOLPP1 in relation to hibernation in Rhinolophus ferrumequinum, we can formulate hypotheses based on the differential gene expression patterns observed during hibernation in this species and the known functions of DOLPP1:

During hibernation, the greater horseshoe bat undergoes substantial metabolic reprogramming, particularly in the liver, where many genes involved in metabolism are differentially expressed . Specifically, genes involved in carbohydrate catabolism are down-regulated during hibernation, while genes responsible for lipid β-oxidation are up-regulated .

Potential Roles of DOLPP1 in Hibernation:

  • Glycoprotein Synthesis Regulation: As DOLPP1 is involved in the glycosylation pathway, its expression might be regulated during hibernation to adjust the rate of glycoprotein synthesis to match the reduced metabolic state.

  • Membrane Adaptation: Proper glycosylation of membrane proteins is essential for their function and stability at different temperatures. DOLPP1 might play a role in adapting membrane composition during hibernation.

  • Integration with Metabolic Shifts: The shift from carbohydrate to lipid metabolism during hibernation, as evidenced by the downregulation of glycolysis genes (GCK, HK1, PFKFB3, PFKFB1, PYGM, PFKP) and upregulation of lipid metabolism genes (ACOT12, ACOX1, EHHADH, SLC27A6) , might involve coordinated changes in glycosylation patterns regulated in part by DOLPP1.

To investigate these hypotheses, researchers could design experiments to measure DOLPP1 expression and activity in tissues from active versus torpid bats, similar to the qRT-PCR validation approach described in the literature . Correlation analysis between DOLPP1 expression and the expression of known hibernation-regulated genes could provide insights into its potential role in this physiological adaptation.

How can genetic manipulation of DOLPP1 be used to study its function in cellular models?

Genetic manipulation of DOLPP1 provides powerful tools for elucidating its cellular functions through gain-of-function and loss-of-function approaches. For Rhinolophus ferrumequinum DOLPP1, researchers can implement the following strategies:

CRISPR/Cas9 Gene Editing:

  • Design guide RNAs targeting conserved regions of the DOLPP1 gene

  • Create knockout cell lines to observe loss-of-function phenotypes

  • Generate knock-in cell lines with tagged versions for localization studies

  • Introduce specific mutations to study structure-function relationships

RNA Interference (RNAi):

  • Design siRNAs or shRNAs targeting DOLPP1 mRNA for transient or stable knockdown

  • Validate knockdown efficiency using qRT-PCR (similar to the method described in )

  • Assess phenotypic changes in glycosylation patterns, ER stress responses, or membrane composition

Overexpression Systems:

  • Clone the full-length DOLPP1 sequence into appropriate expression vectors

  • Create stable cell lines overexpressing wild-type or mutant DOLPP1

  • Assess the effects on dolichol metabolism and glycosylation pathways

Inducible Expression Systems:

  • Utilize tetracycline-inducible or similar systems to control DOLPP1 expression temporally

  • Monitor acute versus chronic effects of DOLPP1 modulation

Functional Readouts to Consider:

  • N-glycosylation efficiency using glycoprotein markers

  • ER stress response through UPR pathway activation

  • Membrane composition and fluidity

  • Cell survival under stress conditions (particularly relevant to hibernation biology)

These approaches can be particularly informative when combined with the DOE methodology described earlier , allowing for systematic investigation of how DOLPP1 genetic manipulation interacts with other factors like temperature or nutrient availability to influence cellular physiology.

What are the current challenges in expressing and studying recombinant DOLPP1 and how can they be addressed?

Expressing and studying recombinant DOLPP1 from Rhinolophus ferrumequinum presents several technical challenges that researchers need to address methodically:

1. Membrane Protein Expression Challenges:

  • Challenge: DOLPP1 contains transmembrane domains that make heterologous expression difficult.

  • Solution: Use specialized expression systems designed for membrane proteins, such as C41/C43 E. coli strains, yeast (P. pastoris), or mammalian cell lines. Consider codon optimization for the expression host.

2. Protein Solubility and Purification:

  • Challenge: Maintaining native conformation during extraction and purification.

  • Solution: Screen multiple detergents (DDM, LMNG, GDN) at various concentrations. Consider nanodiscs or amphipols for maintaining native-like lipid environments.

3. Enzymatic Activity Preservation:

  • Challenge: Preserving catalytic activity during purification and storage.

  • Solution: Include glycerol (50%) in storage buffers and optimize buffer conditions (pH, salt concentration) based on systematic screening . Incorporate stabilizing agents like specific lipids that might be required for activity.

4. Structural Characterization:

  • Challenge: Obtaining structural information for a membrane protein.

  • Solution: Combine computational approaches (homology modeling based on related structures) with experimental methods like hydrogen-deuterium exchange mass spectrometry (HDX-MS) or cryo-EM for larger complexes.

5. Physiological Relevance:

  • Challenge: Relating in vitro findings to in vivo function, particularly in the context of hibernation.

  • Solution: Develop cell-based assays that mimic aspects of hibernation (temperature shifts, metabolic changes) and validate findings in primary cells from R. ferrumequinum when possible.

6. Species-Specific Antibodies:

  • Challenge: Limited availability of antibodies specific to R. ferrumequinum DOLPP1.

  • Solution: Develop custom antibodies against unique epitopes or use epitope tags in recombinant constructs. Validate antibody specificity through knockout controls.

Addressing these challenges requires an integrated approach that combines molecular biology, biochemistry, and structural biology techniques. Researchers should consider collaborations with specialists in membrane protein biochemistry and hibernation physiology to overcome these technical hurdles effectively.

How might the study of R. ferrumequinum DOLPP1 contribute to our understanding of glycobiology and hibernation physiology?

The study of Rhinolophus ferrumequinum DOLPP1 represents a unique opportunity to bridge two important biological fields: glycobiology and hibernation physiology. This intersection can yield significant insights with broader implications:

Contributions to Glycobiology:

  • Adaptation of Glycosylation Machinery: By studying how DOLPP1 functions in a hibernating species, researchers can understand how the glycosylation machinery adapts to extreme physiological states. This could reveal fundamental principles about the plasticity of glycosylation processes.

  • Temperature-Dependent Enzyme Kinetics: Investigating how R. ferrumequinum DOLPP1 functions across temperature ranges (from normal body temperature to hibernation temperatures) could reveal novel insights about the evolution of enzyme temperature sensitivity in mammals.

  • Membrane Glycobiology: DOLPP1's role in recycling dolichol phosphates affects membrane composition and function. Studies in bats could reveal how membrane glycobiology adapts during metabolic stress conditions.

Contributions to Hibernation Physiology:

  • Metabolic Shifting Mechanisms: Integration with known hibernation-associated gene expression changes, such as the downregulation of glycolysis and upregulation of lipid metabolism genes , could reveal how glycosylation pathways adjust during metabolic reprogramming.

  • Cellular Stress Responses: Proper protein glycosylation is essential for protein folding and ER stress prevention. Understanding how DOLPP1 contributes to maintaining cellular homeostasis during torpor could provide insights into natural cytoprotective mechanisms.

  • Organ Preservation: The liver undergoes significant changes during hibernation, as shown by differential gene expression studies . DOLPP1's potential role in maintaining organ function during prolonged cold exposure and metabolic depression could inform biomedical approaches to organ preservation.

Experimental Approaches:

To explore these intersections, researchers could:

  • Compare DOLPP1 expression and activity in tissues from active versus torpid R. ferrumequinum

  • Analyze glycosylation profiles of key proteins during different hibernation states

  • Develop in vitro models that mimic hibernation conditions to study DOLPP1 function

  • Examine the integration of DOLPP1 activity with lipid metabolism pathways that are upregulated during hibernation

These studies could ultimately contribute not only to our understanding of bat biology but also to biomedical applications in organ preservation, metabolic disorders, and protein folding diseases.

What are the best approaches for analyzing DOLPP1 expression in different tissues and physiological states?

Comprehensive analysis of DOLPP1 expression across tissues and physiological states requires a multi-platform approach to ensure robust and reproducible results:

RNA-level Expression Analysis:

  • RNA-Seq: For global transcriptomic analysis, follow protocols similar to those used in differential gene expression studies of R. ferrumequinum liver during hibernation . This approach allows comparison of DOLPP1 expression with other genes in various metabolic pathways.

  • qRT-PCR Validation: Design specific primers for R. ferrumequinum DOLPP1, with β-actin as a reference gene. Use the 2^-ΔΔCT method for relative quantification .

    Sample protocol parameters:

    • RNA extraction: TRIzol method followed by DNase treatment

    • cDNA synthesis: Use oligo(dT) and random primers

    • qPCR conditions: 95°C for 1min, then 40 cycles of 95°C for 15s and 60°C for 1min

    • Technical replicates: Minimum of 2 per sample

    • Biological replicates: Minimum of 5 per condition (active vs. torpid)

Protein-level Expression Analysis:

  • Western Blotting: Use antibodies against conserved DOLPP1 epitopes or tagged recombinant versions.

  • Mass Spectrometry: Employ targeted proteomics approaches (PRM or MRM) to quantify DOLPP1 across samples.

  • Immunohistochemistry: Visualize tissue distribution of DOLPP1 to identify cell-type specific expression patterns.

Activity Assays:

  • Enzymatic Activity: Measure DOLPP1 phosphatase activity using dolichyl pyrophosphate substrates and detect released phosphate.

  • In Situ Activity: Develop assays to measure activity in tissue homogenates under native conditions.

Data Integration and Analysis:

  • Correlation Analysis: Correlate DOLPP1 expression with hibernation markers and metabolic enzymes.

  • Temporal Profiling: Monitor expression changes throughout the hibernation cycle, including entry, deep torpor, arousal, and interbout euthermia.

  • Statistical Analysis: Apply appropriate statistical methods (ANOVA, t-tests) with correction for multiple comparisons, such as the Benjamini-Hochberg method to control false discovery rate at 0.1% .

This comprehensive approach provides multiple lines of evidence for DOLPP1 expression patterns and helps establish its role in different physiological contexts, particularly during the transition between active and torpid states in R. ferrumequinum.

How can researchers effectively quantify and characterize the enzymatic activity of recombinant DOLPP1?

Effective quantification and characterization of recombinant DOLPP1 enzymatic activity requires carefully designed assays that account for the membrane-associated nature of the enzyme and its specific substrate requirements:

Enzymatic Activity Assay Protocols:

  • Phosphate Release Assay:

    • Substrate: Dolichyl pyrophosphate (Dol-P-P)

    • Detection: Malachite green assay for released inorganic phosphate

    • Controls: Heat-inactivated enzyme and substrate-free reactions

    • Quantification: Standard curve with known phosphate concentrations

    • Assay conditions: Optimize pH (6.5-7.5) and temperature (25-37°C)

  • Coupled Enzyme Assay:

    • Principle: Link DOLPP1 activity to a secondary reaction with spectrophotometric output

    • Coupling enzymes: Pyrophosphatase and purine nucleoside phosphorylase

    • Detection: Absorbance change at 360nm

    • Advantage: Continuous real-time monitoring of activity

Kinetic Characterization:

  • Michaelis-Menten Kinetics:

    • Vary substrate concentration (0.1-10× Km)

    • Determine Km, Vmax, and kcat

    • Calculate catalytic efficiency (kcat/Km)

  • Inhibition Studies:

    • Test potential physiological regulators

    • Determine inhibition constants (Ki)

    • Identify inhibition mechanisms (competitive, non-competitive, etc.)

Environmental Factor Analysis:

  • Temperature Dependence:

    • Measure activity across temperature range (4-40°C)

    • Calculate activation energy (Ea) using Arrhenius plot

    • Compare activity at normal body temperature vs. hibernation temperature

  • pH Profile:

    • Determine optimal pH and pH stability

    • Analyze ionizable groups involved in catalysis

  • Metal Ion Dependence:

    • Screen effects of divalent cations (Mg²⁺, Mn²⁺, Ca²⁺)

    • Determine metal binding constants

Detergent and Lipid Effects:

  • Detergent Screening:

    • Test activity in various detergents (DDM, CHAPS, digitonin)

    • Optimize detergent concentration for maximal activity

  • Lipid Requirement:

    • Supplement assays with specific phospholipids

    • Reconstitute in liposomes or nanodiscs for native-like environment

Data Analysis and Interpretation:

  • Statistical Analysis:

    • Perform all measurements in triplicate

    • Calculate mean ± standard deviation

    • Use appropriate statistical tests for comparisons

  • Comparative Analysis:

    • Compare R. ferrumequinum DOLPP1 with orthologs from non-hibernating species

    • Correlate enzymatic properties with physiological adaptations

These methodologies provide a comprehensive framework for characterizing the enzymatic properties of recombinant DOLPP1, enabling researchers to understand its biochemical behavior in the context of hibernation physiology and glycosylation pathways.

What are the most promising research directions for understanding the role of DOLPP1 in bat hibernation physiology?

The investigation of DOLPP1 in bat hibernation physiology represents an emerging frontier with several promising research directions:

1. Integrated Multi-omics Approaches:

  • Combine transcriptomics, proteomics, and glycomics to develop a comprehensive understanding of how DOLPP1 regulation affects the glycosylation landscape during hibernation

  • Correlate DOLPP1 expression and activity with global changes in protein glycosylation patterns

  • Integrate these findings with metabolomic data to understand the relationship between glycosylation and the metabolic shift observed during hibernation

2. Tissue-Specific Regulation:

  • Expand beyond liver studies to examine DOLPP1 expression in other hibernation-relevant tissues (brown adipose tissue, brain, skeletal muscle)

  • Compare tissue-specific regulation patterns to identify common and unique regulatory mechanisms

  • Investigate how these differences contribute to tissue-specific hibernation responses

3. Temperature-Adaptive Mechanisms:

  • Characterize the temperature sensitivity of R. ferrumequinum DOLPP1 compared to orthologs from non-hibernating species

  • Investigate structural adaptations that may enable enzyme function at low body temperatures

  • Explore potential cold-adaptive mutations through site-directed mutagenesis and functional assays

4. Temporal Dynamics During Hibernation Cycles:

  • Monitor DOLPP1 expression and activity throughout the complete hibernation cycle, including:

    • Pre-hibernation preparation

    • Entry into torpor

    • Deep torpor maintenance

    • Periodic arousal

    • Post-hibernation recovery

  • Correlate these changes with physiological parameters and other molecular markers

5. Regulatory Network Analysis:

  • Identify transcription factors and signaling pathways that regulate DOLPP1 expression during hibernation

  • Explore the potential role of microRNAs in post-transcriptional regulation of DOLPP1

  • Develop network models that integrate DOLPP1 with other differentially expressed genes identified in hibernation studies

6. Functional Validation Through Genetic Manipulation:

  • Develop cell culture models that mimic hibernation conditions (temperature cycling, nutrient restriction)

  • Use CRISPR/Cas9 to modify DOLPP1 in these models and assess effects on glycosylation and cellular stress responses

  • Consider the development of bat cell lines that better represent the native cellular environment

These research directions would significantly advance our understanding of the molecular mechanisms underlying hibernation in bats and potentially reveal novel insights into glycobiology, metabolic adaptation, and cellular survival under stress conditions. The findings could also have broader implications for biomedical applications, including organ preservation, ischemia-reperfusion injury prevention, and metabolic disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.