Recombinant Rhinolophus ferrumequinum Suppressor of tumorigenicity 7 protein (ST7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
ST7; Suppressor of tumorigenicity 7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Rhinolophus ferrumequinum (Greater horseshoe bat)
Target Names
ST7
Target Protein Sequence
MAEAGTGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTP KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSN GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDS DHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCAT AYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKR RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD ISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKG HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELM GVFAKAMIDMFCSAELRDWNCKSIFMRVEDELEIPSAPQSQHFQT
Uniprot No.

Target Background

Protein Families
ST7 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is ST7 protein and what are its key structural domains in Rhinolophus ferrumequinum?

ST7 (Suppression of Tumorigenicity 7) is a type I transmembrane protein belonging to the LDL receptor (LDLR) superfamily, also designated as LRP12. While specific structural characterization of Rhinolophus ferrumequinum ST7 remains limited, comparative analysis with human ST7 indicates it likely contains similar functional domains. Human ST7 consists of approximately 859 amino acids including a 32 amino acid signal sequence, a 460 amino acid extracellular domain containing two CUB domains and five LDLR class A domains, a 21 amino acid transmembrane domain, and a 346 amino acid cytoplasmic domain with motifs implicated in endocytosis and signal transduction .

Researchers investigating the bat variant should consider the high sequence homology between mammalian ST7 proteins, which typically show 95-98% amino acid sequence conservation within the extracellular domain across species . This conservation suggests similar structural arrangement in the Rhinolophus ferrumequinum ST7 protein.

How does Rhinolophus ferrumequinum ST7 compare to human ST7 in terms of sequence homology and functional domains?

Comparative sequence analysis between human and Rhinolophus ferrumequinum ST7 reveals significant conservation. Based on cross-species comparisons, the extracellular domain of ST7 demonstrates remarkable evolutionary conservation among mammals, with human ST7 sharing 95% amino acid sequence homology with mouse and rat versions, and even higher conservation (96-98%) with other mammals such as bovine, equine, and porcine variants .

The predicted functional domains in Rhinolophus ferrumequinum ST7 likely include:

  • Signal sequence (~32 aa)

  • Extracellular domain (~460 aa) containing:

    • Two CUB domains

    • Five LDLR class A domains

  • Transmembrane domain (~21 aa)

  • Cytoplasmic domain (~346 aa) containing motifs for:

    • Endocytosis

    • Signal transduction

When designing experiments targeting specific domains, researchers should consider this high degree of conservation while accounting for bat-specific variations that might influence protein-protein interactions or signaling pathways.

What are the optimal expression systems for producing recombinant Rhinolophus ferrumequinum ST7 protein?

Based on established protocols for mammalian recombinant proteins, several expression systems can be employed for Rhinolophus ferrumequinum ST7, each with specific advantages:

Expression SystemAdvantagesChallengesRecommended For
E. coliHigh yield, cost-effective, rapid expressionMay lack proper post-translational modifications, potential for improper folding of mammalian proteinsIndividual domains, protein fragments
Mammalian cells (HEK293)Native-like post-translational modifications, proper foldingLower yield, higher cost, longer production timeFull-length protein, functional studies
Insect cellsHigher yield than mammalian cells, some post-translational modificationsNot all mammalian modifications are reproducedBalance between yield and functionality

For functional studies requiring proper folding and post-translational modifications, mammalian expression systems (particularly HEK293 cells) are recommended despite lower yields . When studying individual domains or when post-translational modifications are less critical, E. coli systems may provide sufficient material for structural studies at higher yields.

What purification strategies are most effective for isolating recombinant Rhinolophus ferrumequinum ST7 with preserved functional properties?

Effective purification of recombinant Rhinolophus ferrumequinum ST7 typically involves multi-step chromatographic approaches. Based on protein characteristics, the following purification strategy is recommended:

  • Initial capture: Affinity chromatography using:

    • His-tag purification (if expressed with histidine tag)

    • Immunoaffinity chromatography using anti-ST7 antibodies

  • Intermediate purification:

    • Ion exchange chromatography based on theoretical pI of ST7

    • Hydrophobic interaction chromatography

  • Polishing:

    • Size exclusion chromatography to separate monomeric protein from aggregates

To preserve functional properties throughout purification:

  • Maintain temperature at 4°C during all steps

  • Include protease inhibitors in buffers

  • Consider adding stabilizing agents (glycerol, specific ions)

  • Minimize freeze-thaw cycles

  • Perform activity assays after each purification step to monitor functional integrity

For transmembrane proteins like ST7, including appropriate detergents during extraction and purification is critical for maintaining native conformation and function.

What experimental approaches are most suitable for investigating the tumor suppressor function of ST7 from Rhinolophus ferrumequinum?

Investigation of tumor suppressor function in Rhinolophus ferrumequinum ST7 requires multiple complementary approaches:

  • Cell-based functional assays:

    • Colony formation assays to assess growth inhibition

    • Soft agar assays to evaluate anchorage-independent growth suppression

    • Cell proliferation assays using bat or human cancer cell lines with ST7 knockout/restoration

  • Mutational analysis:

    • CRISPR-Cas9 gene editing to introduce mutations found in cancer samples

    • Site-directed mutagenesis of conserved domains to assess functional consequences

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify binding partners

    • Yeast two-hybrid screening using bat ST7 as bait

    • Proximity labeling methods (BioID, APEX) to identify proximal proteins in native context

  • Gene expression profiling:

    • RNA-seq analysis of cells expressing wild-type versus mutant ST7

    • ChIP-seq to identify potential downstream targets if ST7 has transcriptional effects

Current research suggests that genetic alteration by nucleotide mutation within ST7 is very rare in epithelial cancers and tumor cell lines, indicating that if ST7 functions as a tumor suppressor, it might be inactivated by epigenetic mechanisms or haplo-insufficiency rather than direct mutation . This should be considered when designing functional experiments.

How can researchers distinguish between direct and indirect effects of ST7 in cellular pathways?

Distinguishing between direct and indirect effects of ST7 requires careful experimental design and multiple methodologies:

  • Temporal analysis:

    • Time-course experiments with inducible ST7 expression systems

    • Rapid induction methods (e.g., auxin-inducible degron systems) to identify immediate responses

    • Pulse-chase experiments to track signaling cascade progression

  • Domain-specific manipulations:

    • Expression of truncated variants containing specific functional domains

    • Point mutations in interaction motifs to disrupt specific pathways

    • Domain swapping experiments with other LDLR family proteins

  • Proximity-dependent labeling:

    • Fusion of ST7 with BioID or APEX2 to identify proteins in close proximity

    • Comparison of labeled proteomes across different cell compartments

  • Direct binding assays:

    • Surface plasmon resonance (SPR) with purified components

    • Microscale thermophoresis to measure binding affinities

    • Fluorescence resonance energy transfer (FRET) for live-cell interaction detection

When interpreting results, consider that ST7 contains motifs implicated in endocytosis and signal transduction , suggesting it may function within complex signaling networks with both direct binding partners and downstream effectors separated by multiple signaling steps.

What evolutionary insights can be gained from comparing ST7 across bat species and other mammals?

Evolutionary analysis of ST7 across species offers valuable insights into conservation, adaptation, and functional constraints:

  • Sequence conservation analysis:
    The high degree of sequence conservation in ST7 across mammals (95-98% amino acid sequence homology in the extracellular domain) suggests strong evolutionary pressure to maintain structure and function. Comparison between Rhinolophus ferrumequinum and other bat species may reveal:

    • Bat-specific adaptations in ST7 structure

    • Lineage-specific selection pressures

    • Correlation between evolutionary rate and species longevity/cancer resistance

  • Domain evolution:
    Comparative analysis of domain architecture across species can identify:

    • Conserved functional motifs essential for core functions

    • Variable regions potentially involved in species-specific interactions

    • Evolutionary history of domain acquisition/loss

  • Selection analysis:
    Calculation of dN/dS ratios across different regions of the ST7 gene can reveal:

    • Sites under positive selection (potentially involved in species-specific adaptations)

    • Regions under purifying selection (likely essential for function)

    • Evidence of convergent evolution in unrelated species with similar environmental pressures

  • Expression pattern comparison:
    Analysis of ST7 expression across tissues in different species may reveal:

    • Conservation of expression profiles suggesting maintained regulatory mechanisms

    • Species-specific expression differences indicating functional diversification

The exceptional longevity and cancer resistance observed in many bat species makes comparative ST7 analysis particularly valuable for understanding potential adaptations in tumor suppressor pathways.

How do post-translational modifications of ST7 differ between Rhinolophus ferrumequinum and other mammals, and what are the functional implications?

Post-translational modifications (PTMs) of ST7 potentially differ between Rhinolophus ferrumequinum and other mammals, with several functional implications:

  • Glycosylation patterns:
    The extracellular domain of ST7 contains potential N-linked glycosylation sites within the LDLR class A domains. Species-specific differences in glycosylation may affect:

    • Protein folding and stability

    • Receptor-ligand interactions

    • Resistance to proteolytic degradation

    • Cell surface retention time

  • Phosphorylation sites:
    The cytoplasmic domain contains motifs implicated in signal transduction that may be regulated by phosphorylation. Comparative phosphoproteomic analysis may reveal:

    • Conservation of regulatory phosphorylation sites

    • Bat-specific phosphorylation patterns

    • Differential regulation by kinases and phosphatases

  • Methodological approaches for PTM analysis:

    • Mass spectrometry-based comparative PTM mapping

    • Site-directed mutagenesis of predicted PTM sites

    • Phospho-specific antibodies for detecting activation states

    • Glycoproteomic analysis of recombinant proteins from different expression systems

  • Functional implications:
    Species-specific PTMs may explain differences in:

    • Signaling pathway integration

    • Protein half-life and turnover

    • Subcellular localization

    • Protein-protein interaction networks

When studying recombinant Rhinolophus ferrumequinum ST7, researchers should carefully consider the expression system to ensure proper PTMs; mammalian cell expression systems (particularly HEK293) are recommended for functional studies requiring native-like modifications .

What mechanisms might explain the apparent lack of ST7 mutations in cancer despite its proposed tumor suppressor function?

The paradox of ST7's proposed tumor suppressor role despite the rarity of mutations in cancer can be explained through several mechanisms:

  • Alternative inactivation mechanisms:
    Research suggests that if ST7 functions as a tumor suppressor, it might be inactivated by mechanisms other than direct mutation :

    • Epigenetic silencing through promoter hypermethylation

    • Histone modifications leading to chromatin remodeling

    • Regulation by non-coding RNAs (including ST7-AS1, the antisense RNA)

    • Post-translational modifications affecting protein stability

  • Haplo-insufficiency:
    ST7 may function in a dose-dependent manner where:

    • Complete loss is not required for oncogenic effects

    • Reduced expression below a critical threshold is sufficient

    • Mono-allelic loss at chromosome 7q31.1 could produce partial loss of function

  • Context-dependent tumor suppression:
    ST7 function may be:

    • Cell-type specific, explaining variable effects across cancer types

    • Dependent on specific signaling environments

    • Most relevant during particular stages of tumorigenesis

  • Methodological considerations:
    Earlier studies may have had limitations in:

    • Coverage of regulatory regions

    • Detection of larger structural variations

    • Analysis of epigenetic modifications

    • Sample size and representation of cancer subtypes

Research approaches should expand beyond mutation screening to include comprehensive epigenetic analysis, expression profiling across cancer types, and functional studies in relevant cellular contexts.

How can studying ST7 in Rhinolophus ferrumequinum contribute to understanding cancer resistance in bats?

Studying ST7 in Rhinolophus ferrumequinum offers unique insights into cancer resistance mechanisms in bats, which show remarkably low cancer rates despite their longevity. Research approaches should include:

  • Comparative functional analysis:

    • Side-by-side testing of bat and human ST7 in tumor suppression assays

    • Chimeric protein studies to identify domains responsible for differential activity

    • Assessment of response to oncogenic challenges in cells expressing bat versus human ST7

  • Regulatory network comparison:

    • Identification of species-specific ST7 interacting partners

    • Analysis of downstream pathway activation differences

    • Evaluation of ST7 regulation in response to DNA damage or cellular stress

  • Integration with bat-specific adaptations:

    • Correlation with other known bat cancer resistance mechanisms

    • Assessment of ST7 function in the context of:

      • Enhanced DNA repair pathways in bats

      • Altered metabolic regulation

      • Unique immune surveillance mechanisms

      • Telomere maintenance adaptations

  • Experimental approaches:

    • Development of bat cell lines for in vitro studies

    • CRISPR-engineered human cells expressing bat ST7 variants

    • Heterologous expression systems to isolate specific functions

    • Proteomic analysis of species-specific signaling complexes

The greater horseshoe bat (Rhinolophus ferrumequinum) has a remarkable lifespan of up to 30 years despite its small body size , making its tumor suppressor mechanisms particularly interesting for comparative oncology research.

What are the methodological challenges in studying protein-protein interactions of Rhinolophus ferrumequinum ST7?

Investigating protein-protein interactions of Rhinolophus ferrumequinum ST7 presents several methodological challenges that require specialized approaches:

  • Species-specific interaction partners:

    • Limited availability of bat-specific antibodies and reagents

    • Potential cross-reactivity issues with antibodies developed against human proteins

    • Need for custom antibody development or epitope tagging strategies

    • Consideration of host cell background in heterologous expression systems

  • Membrane protein complexes:
    As a transmembrane protein, ST7 presents unique challenges:

    • Detergent selection for membrane protein extraction without disrupting interactions

    • Maintaining native conformations during purification

    • Capturing transient or weak interactions at the membrane interface

    • Distinguishing direct binding from co-localization in membrane microdomains

  • Advanced methodological approaches:

    TechniqueApplicationAdvantagesLimitations
    Proximity labeling (BioID, APEX)In situ interaction mappingCaptures weak/transient interactions, works in native contextRequires genetic manipulation, potential background
    Crosslinking Mass SpectrometryDirect interaction sitesIdentifies specific binding interfaces, works with endogenous proteinsComplex data analysis, limited depth
    FRET/BRETLive-cell interaction dynamicsReal-time monitoring, detects conformational changesRequires fluorescent tags, potential interference
    Native PAGEIntact complex isolationPreserves native interactionsLimited to stable complexes, low resolution
    Single-molecule pull-downStoichiometry determinationPrecise subunit counting, works with limited materialTechnically challenging, specialized equipment
  • Validation strategies:

    • Reciprocal co-immunoprecipitation with multiple antibodies/tags

    • Domain mapping through truncation mutants

    • Competition assays with peptides derived from interaction interfaces

    • Functional assays to assess biological relevance of identified interactions

When developing interaction studies, researchers should consider the cellular compartmentalization of ST7 and design experiments that can capture interactions in the appropriate subcellular context.

What are the current limitations in structural analysis of ST7, and how might they be overcome?

Structural analysis of ST7 faces significant challenges due to its complex multi-domain architecture and transmembrane nature. Current limitations and potential solutions include:

  • Challenges in full-length protein structure determination:

    • Large size (~859 amino acids) exceeds optimal range for NMR

    • Transmembrane region complicates crystallization

    • Multiple flexible domains may create conformational heterogeneity

    Solutions:

    • Domain-by-domain structural analysis

    • Stabilization through antibody fragments or nanobodies

    • Limited proteolysis to identify stable domains

  • Expression and purification limitations:

    • Difficulty obtaining sufficient quantities of properly folded protein

    • Maintaining stability during concentration for structural studies

    • Proper incorporation of post-translational modifications

    Solutions:

    • Optimization of expression systems (mammalian, insect cells)

    • Fusion partners to enhance solubility and stability

    • Detergent screening for optimal extraction and stability

  • Current methodological approaches:

    TechniqueApplicability to ST7AdvantagesLimitations
    X-ray crystallographyIndividual domainsHigh resolutionDifficult crystallization of flexible/membrane proteins
    Cryo-EMFull-length or large fragmentsWorks with larger proteins, fewer crystals neededLower resolution for smaller domains, sample heterogeneity
    NMR spectroscopySmall domains (<25 kDa)Dynamic information, solution stateSize limitations, large quantity needed
    Small-angle X-ray scattering (SAXS)Domain arrangementsWorks in solution, low sample requirementsLow resolution, model ambiguity
    Hydrogen-deuterium exchange MSConformational dynamicsMaps flexible regions, minimal sampleIndirect structural information
    AlphaFold2 and other AI approachesPrediction of domainsRapid, improving accuracyLimitations with novel folds and domain arrangements
  • Integrative structural biology approaches:

    • Combining multiple techniques (cryo-EM, crosslinking-MS, SAXS)

    • Computational modeling constrained by experimental data

    • Evolutionary coupling analysis to predict contacts

    • Domain-level structures assembled into composite models

The most promising near-term approach may be a divide-and-conquer strategy focusing on individual domains, particularly the extracellular LDLR domains, which have structural homology to better-characterized proteins in the LDLR family.

How should researchers design experiments to compare ST7 function across different mammalian cell types?

Designing robust comparative experiments for ST7 function across mammalian cell types requires careful consideration of multiple factors:

  • Cell line selection strategy:

    • Include cell lines from multiple species with varying endogenous ST7 expression

    • Consider normal and cancer-derived cell lines for comparison

    • Include bat cell lines (if available) alongside human and mouse models

    • Select cells representing tissues with high natural ST7 expression (heart, skeletal muscle, fibroblasts)

  • Expression system standardization:

    • Use identical promoters and regulatory elements across cell types

    • Consider lentiviral systems for consistent integration and expression

    • Include epitope tags that don't interfere with function for normalization

    • Establish dose-response relationships with inducible expression systems

  • Functional readout selection:

    Functional AspectRecommended AssaysNormalization Strategy
    Growth suppressionColony formation, proliferation rateControl for transfection/transduction efficiency
    Signal transductionPhosphorylation cascades, reporter assaysNormalize to expression level
    Protein interactionsCo-IP, proximity labelingAccount for expression differences
    Subcellular localizationImmunofluorescence, fractionationCompare against standard markers
    Transcriptional effectsRNA-seq, qRT-PCR of target genesUse species-matched reference genes
  • Controls and validation approaches:

    • Paired gain/loss-of-function experiments (overexpression and knockdown)

    • Rescue experiments with wild-type versus mutant forms

    • Domain deletion constructs to map functional regions

    • Parallel assessment of known ST7 downstream targets

    • Appropriate vehicle controls for all treatments

  • Statistical considerations:

    • Power analysis to determine sample size

    • Blocked experimental design to control for batch effects

    • Mixed-effects models to account for technical and biological variation

    • Multiple testing correction for high-dimensional datasets

When interpreting cross-species functional data, consider that ST7 may integrate with different signaling networks across species, potentially resulting in context-dependent functional differences despite high sequence conservation.

What controls are essential when analyzing the effects of ST7 expression on gene regulation and cellular phenotypes?

Robust control strategies are essential for accurate interpretation of ST7's effects on gene regulation and cellular phenotypes:

  • Expression level controls:

    • Dose-dependent expression analysis to distinguish physiological from overexpression artifacts

    • Quantitative western blotting for protein level verification

    • qRT-PCR for transcript level confirmation

    • Inclusion of endogenous ST7 expression range data across tissues

  • Genetic controls:

    Control TypePurposeImplementation
    Empty vectorControls for transfection/transduction effectsIdentical backbone without ST7 insert
    Catalytically dead mutantsDistinguish enzymatic from scaffolding functionsPoint mutations in functional domains
    Domain deletion variantsMap functional regionsSystematic removal of individual domains
    Non-target shRNA/siRNAControl for RNAi effectsSequences targeting non-mammalian genes
    Wild-type rescueValidate specificity of knockdown phenotypesRNAi-resistant cDNA expression
  • Cell-based controls:

    • Parental cell lines without genetic manipulation

    • Time-matched controls for all time course experiments

    • Density-matched controls to account for contact inhibition effects

    • Synchronized cells for cell-cycle dependent phenotypes

    • Single cell clones to control for clonal variation in stable lines

  • Technical controls for gene expression analysis:

    • Spike-in controls for RNA-seq normalization

    • Multiple reference genes for qRT-PCR

    • Technical and biological replicates

    • Batch correction in large-scale experiments

    • Validation of key findings by orthogonal methods

  • Phenotypic assay controls:

    • Positive controls with known effects for each assay

    • Negative controls demonstrating assay dynamic range

    • Parallel assays measuring different aspects of the same phenotype

    • Time-course analysis to capture transient effects

    • Dose-response relationships to establish causality

When studying ST7's effects on gene expression, it's important to consider that ST7 expression may be associated with downstream effects on extracellular matrix molecules involved in remodeling, such as SPARC, IGFBP5, and matrix metalloproteinases , necessitating appropriate controls for these pathways.

What are the most promising approaches for elucidating the complete signaling network of Rhinolophus ferrumequinum ST7?

Mapping the complete signaling network of Rhinolophus ferrumequinum ST7 requires integrated multi-omics approaches:

  • Comprehensive interactome mapping:

    • Proximity-dependent biotinylation (BioID/TurboID) with ST7 as bait

    • Affinity purification-mass spectrometry under various cellular conditions

    • Yeast two-hybrid screening with individual domains as bait

    • Protein complementation assays for validation of key interactions

    • Cross-species interactome comparison with human ST7

  • Phosphoproteomics and signaling dynamics:

    • Quantitative phosphoproteomics following ST7 activation/inhibition

    • Temporal analysis to distinguish direct and secondary effects

    • Kinase inhibitor panels to place ST7 within known signaling cascades

    • Integration with protein-protein interaction data

  • Transcriptional network analysis:

    • RNA-seq following ST7 modulation (overexpression, knockdown, mutation)

    • ChIP-seq for transcription factors affected by ST7 signaling

    • ATAC-seq to assess chromatin accessibility changes

    • Integration with public datasets for enrichment analysis

  • Integrated network approaches:

    ApproachImplementationExpected Outcome
    Multi-level omics integrationCombined analysis of proteomics, phosphoproteomics, transcriptomicsHolistic pathway mapping
    Network perturbation analysisSystematic inhibition of predicted pathway componentsValidation of network connections
    Computational network inferenceMachine learning approaches using multi-omic dataPrediction of unmeasured interactions
    Comparative network biologyCross-species comparison of ST7 networksEvolutionary conserved vs. species-specific functions
  • Functional validation strategies:

    • CRISPR screens targeting components of the predicted network

    • Chemical genetic approaches with small molecule inhibitors

    • Domain-specific mutations to disrupt specific interactions

    • In vivo models to validate key pathway components

This multi-layered approach would provide unprecedented insight into the functional role of ST7 in bat biology, potentially revealing adaptations that contribute to the remarkable cancer resistance observed in many bat species despite their longevity.

How might single-cell approaches enhance our understanding of ST7 function in tissue homeostasis and disease?

Single-cell technologies offer powerful approaches to uncover ST7 functions that may be masked in bulk tissue analyses:

  • Single-cell transcriptomics applications:

    • Identification of cell populations with differential ST7 expression

    • Characterization of ST7-responsive cell states

    • Trajectory analysis to map ST7's role in cellular differentiation

    • Cell-cell communication analysis incorporating ST7 signaling

  • Spatial transcriptomics/proteomics advantages:

    • Mapping ST7 expression in tissue microenvironments

    • Correlation with extracellular matrix components

    • Analysis of ST7-expressing cells and their neighbors

    • Identification of niche-specific ST7 functions

  • Single-cell multi-omic integration:

    TechnologyApplication to ST7 ResearchKey Insights
    CITE-seqCorrelation of ST7 protein and mRNA levelsPost-transcriptional regulation
    scATAC-seq + scRNA-seqChromatin accessibility in ST7-expressing cellsRegulatory networks
    Single-cell proteomicsProtein abundance and modificationsPost-translational regulation
    Spatial proteomicsST7 localization within tissue architectureMicroenvironment context
    Live-cell imagingDynamic ST7 trafficking and signalingTemporal regulation
  • Disease-relevant applications:

    • Tumor microenvironment analysis in bat vs. human cancers

    • Cell-state transitions during disease progression

    • Identification of resistant cell populations

    • Heterogeneous responses to therapeutic intervention

  • Methodological considerations:

    • Development of bat-specific antibodies for protein detection

    • Optimization of single-cell protocols for bat tissues

    • Cross-species transcriptome alignment challenges

    • Computational approaches for integrative analysis

Single-cell approaches could be particularly valuable for understanding ST7's context-dependent functions, as tumor suppressor activity may vary across cell types or states. This may help explain the apparent contradiction between ST7's proposed tumor suppressor role and the rarity of ST7 mutations in cancer , potentially revealing cell-specific vulnerabilities or resistance mechanisms.

What are common pitfalls in recombinant expression of transmembrane proteins like ST7, and how can researchers overcome them?

Recombinant expression of transmembrane proteins like ST7 presents numerous technical challenges that require specific troubleshooting approaches:

  • Low expression yield challenges:

    ChallengeSolutionRationale
    Cytotoxicity during expressionInducible expression systemsControls timing and level of potentially toxic protein
    mRNA instabilityCodon optimization for hostImproves translation efficiency
    Protein misfoldingLower temperature expressionSlows folding to improve accuracy
    Inefficient translationFusion with well-expressed partnersEnhances translation initiation
    DegradationProtease inhibitor cocktailsPrevents proteolytic breakdown
  • Membrane insertion and folding issues:

    • Use of specialized expression hosts (C41/C43 E. coli for bacterial expression)

    • Inclusion of chaperones or foldases as co-expression partners

    • Screening multiple detergents for optimal solubilization

    • Addition of lipid during purification to stabilize transmembrane domains

    • Testing truncated constructs lacking problematic domains

  • Purification and stability problems:

    • Systematic detergent screening (mild non-ionic, zwitterionic, etc.)

    • Use of amphipols or nanodiscs for detergent-free systems

    • Buffer optimization with stability screens

    • Addition of cholesterol or specific lipids

    • Thermostability assays to identify stabilizing conditions

  • Quality control approaches:

    • Size-exclusion chromatography to assess monodispersity

    • Circular dichroism to verify secondary structure

    • Thermal shift assays to measure stability

    • Functional binding assays to confirm proper folding

    • Limited proteolysis to identify flexible or exposed regions

  • Expression system selection:
    For ST7 specifically, mammalian expression systems (HEK293) are recommended for most functional studies due to proper post-translational modifications and folding machinery . E. coli expression may be suitable for individual domains but is likely inadequate for the full-length transmembrane protein with multiple disulfide bonds present in LDLR domains.

When troubleshooting expression of Rhinolophus ferrumequinum ST7, systematic documentation of conditions tested and their outcomes is essential for optimization success.

How can researchers validate that recombinant Rhinolophus ferrumequinum ST7 retains native conformational properties?

Validating the native conformational properties of recombinant Rhinolophus ferrumequinum ST7 requires multiple complementary approaches:

  • Structural integrity assessment:

    TechniqueApplicationInformation Provided
    Circular dichroism (CD)Secondary structure analysisConfirms proper α-helix/β-sheet content
    Intrinsic fluorescenceTertiary structure assessmentEvaluates tryptophan environment
    Limited proteolysisDomain organizationIdentifies accessible protease sites
    Thermal shift assaysStability measurementDetermines melting temperature
    Dynamic light scatteringAggregation assessmentConfirms monodispersity
  • Functional validation approaches:

    • Ligand binding assays (if known ligands exist)

    • Interaction with verified binding partners from co-immunoprecipitation

    • Conformational antibodies recognizing native epitopes

    • Activity assays measuring downstream signaling activation

    • Cellular localization matching endogenous protein

  • Glycosylation and post-translational modification analysis:

    • Lectin blotting to detect presence of glycosylation

    • Mass spectrometry to map modification sites

    • Enzymatic deglycosylation to assess contribution to stability

    • Phosphorylation-specific antibodies for key regulatory sites

    • Comparison with modifications detected in native tissues

  • Comparative approaches:

    • Side-by-side analysis with human ST7 as reference

    • Testing under multiple buffer conditions

    • Stability comparison across purification methods

    • Assessment after varying durations of storage

    • Functionality in multiple assay formats

For transmembrane proteins like ST7, reconstitution into membrane-mimetic environments (nanodiscs, liposomes) followed by functional testing provides strong evidence for native conformation. Additionally, cryo-electron microscopy of purified protein can provide structural validation even without achieving atomic resolution.

What are the ethical considerations and alternatives when obtaining primary tissues from protected bat species for ST7 research?

Research involving protected bat species like Rhinolophus ferrumequinum requires careful ethical consideration and implementation of alternatives where possible:

  • Regulatory frameworks:

    • International agreements (CITES, Convention on Biological Diversity)

    • National wildlife protection laws

    • Institutional Animal Care and Use Committee (IACUC) approval

    • Collaboration with conservation authorities for sampling

    • Benefit-sharing agreements with countries of origin

  • Non-lethal sampling approaches:

    Tissue TypeCollection MethodApplications
    Wing membrane punchesSmall biopsy during routine monitoringFibroblast culture, DNA/RNA extraction
    Blood samplesSmall volume collectionImmune cells, plasma proteins, circulating DNA
    Buccal swabsNon-invasive collectionEpithelial cells, microbiome studies
    Fecal samplesNon-invasive collectionGut epithelial cells, microbiome
    Hair folliclesMinimally invasive pluckingDNA extraction, limited RNA studies
  • Alternatives to primary tissue:

    • Development of immortalized bat cell lines from ethically sourced samples

    • Use of existing biobanked specimens from previous studies

    • Computational approaches using published genomic/transcriptomic data

    • Surrogate species approaches with more abundant bat species

    • Recombinant expression of bat proteins in heterologous systems

  • Ethical sampling principles:

    • Sample size justification through power analysis

    • Selection of minimally invasive techniques

    • Training of personnel in bat-specific handling

    • Contribution to conservation efforts as research outcome

    • Sharing of generated data to maximize utility of samples

  • Collaborative frameworks:

    • Partnerships with bat conservation organizations

    • Utilization of samples collected during health monitoring

    • International collaborations to reduce redundant sampling

    • Engagement with local communities in bat habitats

When working with Rhinolophus ferrumequinum, researchers should note that this species is protected in many regions and is listed as "Near Threatened" in some areas of its range. Research plans should include clear justification for why this specific species is necessary rather than more abundant alternatives.

What are the key considerations for designing translational research that bridges ST7 findings from bat species to human health applications?

Translating research findings on ST7 from bat species to human health applications requires strategic planning and consideration of several factors:

  • Cross-species validation pipeline:

    Research PhaseImplementation StrategyValidation Approach
    Initial discoveryComparative genomics/proteomicsEvolutionary conservation analysis
    Mechanism validationParallel studies in bat and human cellsConserved pathway verification
    Pre-clinical testingHumanized models expressing bat ST7Functional outcome assessment
    Translational developmentFocus on conserved functional domainsTarget chemical screening
    Clinical applicationBiomarker developmentCorrelation with disease outcomes
  • Target selection considerations:

    • Focus on mechanisms conserved between bats and humans

    • Identification of druggable nodes in ST7 pathways

    • Assessment of potential off-target effects

    • Evaluation of tissue-specific functions

    • Stratification of patient populations likely to benefit

  • Technology transfer challenges:

    • Intellectual property considerations for bat-derived discoveries

    • Benefit-sharing with countries where bat samples originated

    • Regulatory pathways for novel mechanisms of action

    • Scalability of production for therapeutic development

    • Accessibility considerations for global health impact

  • Translational research design:

    • Simultaneous testing in multiple species models

    • Development of clinically relevant endpoints

    • Identification of predictive biomarkers

    • Consideration of delivery methods for potential therapeutics

    • Integration with existing treatment paradigms

  • Knowledge dissemination strategy:

    • Open science approaches to accelerate translation

    • Cross-disciplinary communication between bat biologists and medical researchers

    • Engagement with industry partners for development

    • Public communication to build understanding of bat research value

    • Policy engagement for sustainable research funding

The exceptional cancer resistance observed in many bat species makes ST7 research particularly valuable for potential cancer prevention or therapeutic strategies in humans, especially if the underlying mechanisms can be translated into interventions that mimic the protective effects observed in bats.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.