Recombinant Rhinolophus pumilus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, briefly centrifuge the vial to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize development according to your specification.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Rhinolophus pumilus (Horseshoe bat)
Target Names
Target Protein Sequence
MALIYTNTLLAFTISLLGLLLYRSHLMSSLLCLEGMMLSMFVMVAVMILNTHLTTSSMMP IVLLVFAACEAALGLSLLVMVSNTYGIDHVQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its functional role in mitochondrial metabolism?

MT-ND4L (mitochondrially encoded NADH dehydrogenase 4L) is a protein-coding gene that provides instructions for making NADH dehydrogenase 4L, a critical component of Complex I in the mitochondrial respiratory chain. This protein participates in the first step of the electron transport process during oxidative phosphorylation, specifically in transferring electrons from NADH to ubiquinone .

Complex I, which contains MT-ND4L, is embedded in the inner mitochondrial membrane and plays a fundamental role in creating the proton gradient necessary for ATP production. When functioning properly, MT-ND4L contributes to the energy-generating capacity of cells by helping to convert the energy from food into ATP, the cell's primary energy currency .

How does the structure of MT-ND4L contribute to its function within Complex I?

MT-ND4L is a relatively small but crucial core subunit of Complex I. The protein consists of approximately 98 amino acids and is highly hydrophobic, allowing it to be embedded within the inner mitochondrial membrane. The amino acid sequence of MT-ND4L is highly conserved across species, reflecting its essential role in cellular respiration .

In Rhinolophus species (such as R. monoceros), the protein maintains the characteristic hydrophobic profile consistent with its membrane-spanning function . The protein's structure includes multiple transmembrane domains that position it strategically within Complex I, enabling it to participate in electron transfer and proton pumping activities.

How is MT-ND4L conserved across different species, particularly within Rhinolophus and other mammalian lineages?

MT-ND4L shows significant conservation across mammalian species, highlighting its essential function in mitochondrial respiration. When comparing the sequence of MT-ND4L across species:

SpeciesSequence ConservationNotable Features
Rhinolophus monocerosReferenceContains characteristic hydrophobic domains
Pichia canadensisPartial homologyPositions 1-511 show functional conservation
HumanHigh conservationMutations associated with specific diseases

The conservation pattern suggests that despite some species-specific variations, the core functional domains of MT-ND4L remain largely unchanged, particularly in the regions involved in electron transport and Complex I assembly.

What expression systems are most effective for producing functional recombinant MT-ND4L?

Multiple expression systems have been utilized for recombinant MT-ND4L production, each with distinct advantages depending on research objectives:

Expression SystemAdvantagesConsiderations
E. coliCost-effective, high yield, rapid expressionMay require optimization for membrane protein folding
Yeast (P. canadensis)Post-translational modifications, better folding for membrane proteinsHigher cost, longer production time
BaculovirusSuperior for complex eukaryotic proteins, better foldingMost expensive, technically demanding
Mammalian cellsNative-like post-translational modificationsHighest cost, lower yields

For studies requiring functional analysis, yeast or mammalian expression systems typically yield more properly folded protein, while E. coli systems may be preferable for structural studies requiring higher yields .

What are the methodological challenges in purifying functional recombinant MT-ND4L and how can they be addressed?

Purification of recombinant MT-ND4L presents several challenges due to its hydrophobic nature and mitochondrial membrane localization. Effective purification strategies should address:

  • Solubilization: Use of appropriate detergents (such as n-dodecyl-β-D-maltoside) to extract MT-ND4L from membranes without denaturing the protein

  • Maintaining native conformation: Inclusion of phospholipids in purification buffers to stabilize membrane protein structure

  • Protein yield: Optimizing expression conditions (temperature, induction time) to balance between quantity and quality

  • Purity assessment: Using methods like SDS-PAGE to achieve ≥85% purity as typically required for functional studies

For Rhinolophus MT-ND4L specifically, a purification protocol involving affinity chromatography with N-terminal and potentially C-terminal tags has shown success in maintaining protein stability and purity .

How do mutations in MT-ND4L contribute to Leber hereditary optic neuropathy (LHON)?

A specific mutation in the MT-ND4L gene (T10663C or Val65Ala) has been identified in several families with Leber hereditary optic neuropathy (LHON). This mutation changes the amino acid valine to alanine at position 65 of the protein .

While the exact pathogenic mechanism remains incompletely understood, evidence suggests that this mutation disrupts the normal activity of Complex I in the mitochondrial inner membrane. The altered protein structure likely impairs electron transport efficiency, potentially increasing reactive oxygen species production and decreasing ATP synthesis. These changes particularly affect retinal ganglion cells, which have high energy demands, leading to the characteristic vision loss in LHON .

What evidence supports the relationship between MT-ND4L variants and Alzheimer's disease?

Recent research has established a significant association between MT-ND4L variants and Alzheimer's disease (AD) risk. A comprehensive study analyzing mitochondrial genomes from the Alzheimer's Disease Sequencing Project found:

  • A rare MT-ND4L variant (rs28709356 C>T) showed study-wide significant association with AD (P = 7.3 × 10⁻⁵)

  • Gene-based tests also revealed significant association between MT-ND4L and AD (P = 6.71 × 10⁻⁵)

  • These findings were consistent with a nuclear mitochondria-related gene (TAMM41) also showing significant association

This study, analyzing data from 10,831 participants, provides substantial evidence for mitochondrial dysfunction—particularly involving MT-ND4L—in AD pathogenesis, suggesting that impaired energy metabolism may contribute to neurodegeneration .

Has research explored potential associations between MT-ND4L polymorphisms and male infertility?

A prospective study conducted between 2018-2019 investigated potential associations between MT-ND4L polymorphisms and male infertility, analyzing 112 semen samples. The study examined seven SNPs in MT-ND4L:

  • rs28358280

  • rs28358281

  • rs28358279

  • rs2853487

  • rs2853488

  • rs193302933

  • rs28532881

Results showed no statistically significant association between these MT-ND4L SNPs and male infertility. Additionally, no significant differences were found between various subgroups of subfertile males (asthenozoospermia, oligozoospermia, teratozoospermia, etc.) .

This contrasts with findings linking MT-ND4L to neurological conditions, suggesting tissue-specific effects of mitochondrial variants or potentially insufficient statistical power in the infertility study.

How can recombinant MT-ND4L be used as a tool to study mitochondrial dysfunction in neurodegenerative disorders?

Recombinant MT-ND4L proteins serve as valuable tools for investigating mitochondrial dysfunction in neurodegenerative disorders through several methodological approaches:

  • In vitro Complex I reconstitution studies: Incorporating recombinant wild-type or mutant MT-ND4L into artificial membrane systems allows researchers to directly measure how specific variants affect Complex I activity, electron transport efficiency, and proton pumping .

  • Structural biology applications: Purified recombinant MT-ND4L can be used for crystallography or cryo-EM studies to understand how disease-associated mutations alter protein folding or interaction surfaces.

  • Protein-protein interaction mapping: Tagged recombinant MT-ND4L can identify binding partners within Complex I and potential interactions with other mitochondrial or cellular components.

  • Development of therapeutic strategies: Wild-type recombinant MT-ND4L can serve as a reference standard for developing mitochondrial targeted therapies or gene replacement strategies.

For Alzheimer's disease specifically, comparing wild-type MT-ND4L with the variant rs28709356 C>T could provide insights into how this mutation contributes to disease pathogenesis .

What advanced techniques are currently employed to study the structural integration of MT-ND4L within Complex I?

Current advanced methodologies for studying MT-ND4L's structural integration within Complex I include:

  • Cryo-electron microscopy (cryo-EM): Provides near-atomic resolution of membrane protein complexes in their native-like environment, revealing MT-ND4L's position and interactions within the complete Complex I structure.

  • Cross-linking mass spectrometry (XL-MS): Identifies spatial relationships between MT-ND4L and other Complex I subunits by chemically linking amino acids that are in close proximity.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps solvent-accessible regions and conformational dynamics of MT-ND4L within the complex.

  • Molecular dynamics simulations: Models how MT-ND4L contributes to proton translocation and electron transfer by simulating atomic movements within the complex.

  • CRISPR-mediated gene editing: Creates specific mutations to test structure-function relationships directly in cellular models.

These techniques collectively provide a comprehensive understanding of how MT-ND4L's structure relates to Complex I function and how disease-associated mutations disrupt these relationships.

What experimental controls should be included when studying recombinant MT-ND4L function?

When designing experiments to study recombinant MT-ND4L function, the following controls are essential:

  • Expression system controls:

    • Empty vector control to account for background expression system effects

    • Expression of a known functional mitochondrial protein (positive control)

    • Expression of an irrelevant protein of similar size/properties (negative control)

  • Purification quality controls:

    • SDS-PAGE with Coomassie staining to verify ≥85% purity

    • Western blot to confirm protein identity

    • Size exclusion chromatography to assess aggregation state

  • Functional assay controls:

    • Native Complex I preparation as positive control for activity assays

    • Heat-inactivated recombinant protein as negative control

    • Known inhibitors of Complex I (e.g., rotenone) as pharmacological controls

  • Mutation analysis controls:

    • Wild-type protein alongside mutant variants

    • Well-characterized disease mutations (e.g., T10663C/Val65Ala)

    • Conservative amino acid substitutions at the same position

Including these controls ensures experimental rigor and facilitates accurate interpretation of results when working with this challenging membrane protein.

What model systems are most appropriate for studying MT-ND4L function and dysfunction?

Various model systems offer distinct advantages for studying MT-ND4L function and associated pathologies:

Model SystemAdvantagesLimitationsBest Applications
Cell-free reconstitutionPrecise biochemical control, direct measurement of Complex I activityLacks cellular contextMechanistic studies of electron transport
Yeast modelsGenetic manipulation, growth phenotype readoutSignificant differences in respiratory chainBasic functional conservation studies
Cultured mammalian cellsDisease-relevant cell types, genetic manipulationLimited systemic responsesDisease mutation effects, drug screening
Patient-derived fibroblastsContains actual disease mutations, patient genetic backgroundLimited access, not neural tissueDirect disease relevance, personalized medicine
Transgenic miceSystemic effects, behavior, tissue-specific analysesTime-consuming, expensiveLong-term pathology, therapeutic testing
DrosophilaRapid generation time, powerful geneticsEvolutionary distance from mammalsHigh-throughput genetic interaction screens

For Rhinolophus MT-ND4L specifically, comparative studies with human MT-ND4L in cellular models can provide insights into species-specific adaptations and conserved functional domains.

How can researchers effectively quantify changes in MT-ND4L activity in experimental systems?

Researchers can employ several complementary approaches to quantify MT-ND4L activity within the context of Complex I function:

  • Enzymatic activity assays:

    • NADH:ubiquinone oxidoreductase activity using spectrophotometric methods

    • Oxygen consumption rate measurements via high-resolution respirometry

    • Membrane potential measurements using fluorescent probes (e.g., TMRM)

  • Structural integrity assessment:

    • Blue native PAGE to evaluate Complex I assembly

    • Immunoprecipitation to assess MT-ND4L incorporation into Complex I

    • Super-resolution microscopy to visualize mitochondrial network integrity

  • Downstream functional endpoints:

    • ATP production measurements

    • Reactive oxygen species quantification

    • Mitochondrial calcium handling capacity

  • Systems biology approaches:

    • Metabolomic profiling to detect shifts in TCA cycle intermediates

    • Transcriptomic analysis of mitochondrial stress responses

    • Proteomic analysis of compensatory changes in respiratory complexes

These methodologies should be applied in combination to comprehensively characterize MT-ND4L function, as single assays may miss subtle or context-dependent effects of mutations or experimental manipulations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.