Recombinant Rhipicephalus sanguineus Cytochrome c oxidase subunit 2 (COII)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Rhipicephalus sanguineus (Brown dog tick) (Ixodes sanguineus)
Target Names
COII
Target Protein Sequence
MMTWSQMSFSDMNSPIMEQMVFFHDHSMMIILMITILTIYMITNIMMNNLLSRSMMEGQE IEIIWTIIPAITLIFIAIPSLHLLYLTDETFNSQISIKVLGHQWYWSYEYSDFNKEFDSF MIPEPEMMKNSFRLLDTDNNLVIPINTNIKYLISSMDVIHSWTIPSLGIKMDAVPGRLNQ SFSISSRPGLYYGQCSEICGANHSFMPISLGVTSMKNFINFINSS
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (COII) is a crucial component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprising Complexes I-IV, facilitates oxidative phosphorylation by transferring electrons from NADH and succinate to molecular oxygen. This process generates a proton gradient across the inner mitochondrial membrane, driving ATP synthesis. COII plays a vital role in this process, contributing to the transfer of electrons from reduced cytochrome c (in the intermembrane space) to the active site of Complex IV. This active site, a binuclear center (BNC) composed of heme a3 and CuB, catalyzes the reduction of oxygen to water, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix. The electron transfer pathway within Complex IV involves the CuA center and heme a before reaching the BNC.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Rhipicephalus sanguineus and why is COII important for its study?

Rhipicephalus sanguineus sensu lato, commonly known as the brown dog tick, is a globally distributed tick species found predominantly across tropical and subtropical regions. It is of significant public health and economic importance as a vector for multiple pathogens that cause diseases in humans and animals, including spotted fever group rickettsioses, babesiosis, ehrlichiosis, and hepatozoonosis .

Cytochrome c oxidase subunit 2 (COII) is a mitochondrial gene that, like its counterpart COI, serves as a valuable genetic marker for:

  • Species identification and delineation within tick genera

  • Population genetic structure analysis

  • Phylogenetic studies and evolutionary relationships

  • Phylogeographic investigations

While COI is more commonly referenced in the literature, COII provides complementary data that can enhance the resolution of genetic studies, particularly when used in conjunction with other markers such as 16S rDNA or nuclear genes like ITS2 .

How does COII differ from other mitochondrial markers used in tick research?

Different mitochondrial markers offer varying levels of resolution and evolutionary information:

MarkerCharacteristicsPrimary Applications
COIIModerate evolutionary rate, good for species/population differentiationSpecies identification, population genetics
COIHigher sequence variability, ~710-bp fragments commonly usedDNA barcoding, species identification, genetic diversity studies
16S rDNAMore conserved, ~432-bp alignment typicalDeeper phylogenetic relationships, genus-level studies
12S rDNAHighly conservedHigher taxonomic level relationships

When studying R. sanguineus populations, mitochondrial markers like COI and 16S rDNA have shown similar topologies in phylogenetic trees and networks, helping to distinguish between the temperate lineage (R. sanguineus s.s.) and tropical lineage of R. sanguineus s.l. . COII would be expected to demonstrate similar discriminatory power while potentially revealing additional population structure details.

What are the standard protocols for extracting tick DNA for COII amplification?

Based on established protocols for similar mitochondrial markers, the following methodology is recommended:

  • Collect tick specimens and preserve them in 70-95% ethanol

  • Morphologically identify specimens before molecular analysis

  • Extract total DNA using commercial kits such as TIANamp Genomic DNA Kit or similar options, following manufacturer's instructions

  • For optimal results, use individual whole ticks or specific tick tissues (depending on research question)

  • Include quality control steps to assess DNA purity and concentration before PCR amplification

For highly sensitive applications, protocols similar to those used for COI amplification can be adapted, where DNA extraction includes careful sample preparation followed by PCR with optimized cycling conditions suitable for mitochondrial gene amplification .

How should researchers design primers for COII amplification in Rhipicephalus sanguineus?

Primer design for COII amplification should follow these methodological guidelines:

  • Reference existing mitochondrial genome sequences of R. sanguineus or closely related species

  • Target conserved regions flanking the COII gene to ensure consistent amplification

  • Design primers with the following characteristics:

    • 18-25 nucleotides in length

    • GC content between 40-60%

    • Similar melting temperatures (within 5°C of each other)

    • Minimal secondary structure and self-complementarity

    • Species-specific if distinguishing between tick genera is required

Similar to approaches used for other markers, researchers should validate primers using known reference samples and optimize PCR conditions through gradient PCR to determine ideal annealing temperatures .

When developing genus-specific primers (as demonstrated for Bm86 gene amplification for Hyalomma and Rhipicephalus), researchers should:

  • Align available sequences to identify conserved regions within the genus

  • Select sequences that show variability between genera but conservation within the target genus

  • Test primer specificity against DNA from multiple tick species to ensure genus-specific amplification

What PCR protocols are most effective for COII amplification from R. sanguineus?

Based on protocols optimized for similar mitochondrial genes, the following PCR approach is recommended:

Reaction mixture (50 μL total volume):

  • 2 μL DNA template

  • 25 μL PCR-grade water

  • 5 μL NH₄ buffer

  • 5 μL dNTPs (2 mM/μL)

  • 2.5 μL MgCl₂ (25 mM/μL)

  • 0.1 μL Taq Polymerase

  • 5 μL each primer (10 pmol/μL)

  • 0.38 μL Bovine Serum Albumin (20 mg/mL) to reduce inhibition

Recommended thermocycler conditions:

  • Initial denaturation: 94°C for 3 minutes

  • 35 cycles of:

    • Denaturation: 94°C for 30 seconds

    • Annealing: 50-55°C for 30 seconds (optimized for specific primers)

    • Extension: 72°C for 1 minute

  • Final extension: 72°C for 10 minutes

  • Hold at 4°C

For difficult samples, nested PCR approaches may increase sensitivity and specificity, particularly when dealing with field-collected specimens that may contain PCR inhibitors .

What are the key considerations when expressing recombinant COII protein in E. coli systems?

Expression of recombinant COII protein in E. coli requires careful attention to several factors:

  • Vector selection: Choose expression vectors with appropriate promoters (such as T7 or Lac) and affinity tags to facilitate purification

  • Codon optimization: Mitochondrial genes like COII have different codon usage than E. coli, so codon optimization is essential to ensure efficient translation

  • Prevention of inclusion body formation: COII, being a hydrophobic membrane protein, is prone to inclusion body formation. Strategies to address this include:

    • Lowering incubation temperature during expression (typically 16-25°C)

    • Using E. coli strains engineered for membrane protein expression

    • Employing solubility-enhancing fusion partners

    • Adding appropriate chaperones to assist proper folding

  • Purification approach: Membrane proteins require specific solubilization and purification protocols involving:

    • Gentle lysis methods

    • Appropriate detergents for solubilization

    • Column chromatography optimized for hydrophobic proteins

Researchers should note that since COII is naturally embedded in the mitochondrial membrane, obtaining properly folded and functional recombinant protein may require additional optimization steps beyond those used for soluble proteins .

How can recombinant COII be used for developing species-specific diagnostic assays for R. sanguineus?

Recombinant COII protein can serve as a valuable tool for developing diagnostic assays through the following approaches:

  • Antibody development:

    • Use purified recombinant COII as an immunogen to produce polyclonal or monoclonal antibodies

    • Validate antibodies for specificity against related tick species

    • Develop immunoassays (ELISA, lateral flow) for field detection of R. sanguineus

  • PCR-based diagnostics:

    • Analyze COII sequences to identify species-specific regions

    • Design primers that target minimal sequence fragments required for identification

    • Develop PCR assays with high specificity and sensitivity (detection limits ~1-2 pg/μl of target DNA), similar to assays developed for other tick markers

  • Validation approach:

    • Test assays on known field samples from diverse geographic regions

    • Evaluate cross-reactivity with closely related species

    • Determine minimum detection thresholds

When developing such diagnostic tools, researchers should follow the model of minimum length marker fragments as demonstrated for Bm86, where specific fragments showed remarkable discriminatory ability in distinguishing Rhipicephalus species at a phylogeographic level .

What phylogenetic insights can COII sequences provide about R. sanguineus population structure?

COII sequences can reveal important phylogenetic and population structure insights:

  • Lineage identification: COII can help distinguish between recognized lineages of R. sanguineus sensu lato, including:

    • Temperate lineage (R. sanguineus s.s.)

    • Tropical lineage

    • Southeastern Europe lineage (Rhipicephalus sp. I)

    • Other distinct genetic groups (e.g., Rhipicephalus sp. III and IV)

  • Phylogeographic patterns: COII sequences can reveal geographic structuring of populations, potentially indicating:

    • Historical migration patterns

    • Isolation by distance effects

    • Introduction events in non-native ranges

  • Evolutionary relationship analysis: Similar to studies with COI and 16S rDNA, COII can be used to:

    • Construct haplotype networks

    • Calculate genetic diversity indices (haplotype diversity, nucleotide diversity)

    • Identify potential hybridization or introgression events between lineages

When analyzing COII data, researchers should employ multiple analytical approaches (phylogenetic trees, networks, population genetics metrics) to fully understand the complexity of R. sanguineus population structure.

What challenges exist in interpreting COII sequence data from field-collected R. sanguineus?

Several important challenges must be considered when interpreting COII data from field samples:

  • Sampling bias:

    • Collection methodology can significantly influence results

    • Host-seeking ticks vs. attached ticks may represent different population subsets

    • Multiple tick cohorts may coexist in the same environment but show different activity patterns

  • Distribution patterns on hosts:

    • Ticks often follow a negative binomial distribution on hosts (few hosts carry most ticks)

    • This uneven distribution can affect sampling representativeness

    • Appropriate statistical methods must be employed to account for this sampling bias

  • Molecular challenges:

    • Potential nuclear mitochondrial pseudogenes (NUMTs) can confound analysis

    • Heteroplasmy (multiple mitochondrial haplotypes in a single individual)

    • PCR artifacts or contamination

  • Taxonomic uncertainty:

    • R. sanguineus is considered a species complex with cryptic diversity

    • Molecular data may not always align with morphological identification

    • Integration of multiple markers (nuclear and mitochondrial) is recommended

Researchers should implement appropriate controls, use multiple markers when possible, and consider the ecological context of their samples to mitigate these challenges.

What are the common pitfalls in recombinant COII protein expression and how can they be addressed?

ChallengeCauseSolution
Inclusion body formationHydrophobic nature of COII, rapid expression rate- Lower expression temperature (16-25°C)
- Use specialized E. coli strains
- Add solubility tags (SUMO, MBP, etc.)
- Express with chaperones
Poor expression levelsCodon bias, toxic effects- Optimize codons for E. coli
- Use tightly regulated promoters
- Consider cell-free expression systems
Protein degradationProtease activity, instability- Add protease inhibitors
- Use protease-deficient strains
- Optimize buffer conditions
Improper foldingMembrane protein nature- Use detergents for solubilization
- Consider lipid nanodiscs
- Employ membrane-mimetic environments

For membrane proteins like COII, researchers should pay particular attention to the expression system selection. While E. coli is commonly used, alternatives like insect cell systems may provide better folding environments for complex membrane proteins .

How can researchers distinguish between COII sequence variations that represent species differences versus population-level polymorphisms?

Distinguishing between species-level differences and population polymorphisms requires a systematic approach:

  • Sequence analysis steps:

    • Calculate genetic distances within and between putative species groups

    • Determine sequence divergence thresholds typical for intraspecific vs. interspecific variation

    • Apply molecular species delimitation methods (e.g., ABGD, bPTP, GMYC)

  • Integrative approach:

    • Compare COII results with other mitochondrial markers (COI, 16S)

    • Include nuclear markers (e.g., ITS2) to detect potential hybridization

    • Correlate molecular findings with morphological and ecological data

  • Validation methods:

    • Cross-breeding experiments (when possible)

    • Host preference and geographical distribution analysis

    • Morphometric studies to identify subtle morphological differences

When analyzing R. sanguineus populations, researchers should be aware that phylogenetic networks often show cross-linking events between lineages, which could suggest potential recombination or hybridization events . This complexity necessitates using multiple markers for accurate species delineation.

What strategies can improve PCR success when amplifying COII from degraded tick samples?

Field-collected ticks often yield degraded DNA that presents challenges for PCR amplification. The following strategies can improve success rates:

  • Modified extraction protocols:

    • Extended proteinase K digestion (overnight at 56°C)

    • Additional purification steps to remove PCR inhibitors

    • Specialized extraction kits designed for difficult or degraded samples

  • PCR optimization:

    • Design shorter amplicons (<300 bp) that target conserved regions

    • Use nested PCR approaches with genus-specific outer primers

    • Add PCR enhancers such as BSA (0.38 μL of 20 mg/mL) to reduce inhibition

    • Implement touchdown PCR protocols to improve specificity

  • Alternative amplification approaches:

    • Whole genome amplification prior to specific PCR

    • Digital droplet PCR for highly sensitive detection

    • LAMP (Loop-mediated isothermal amplification) for field applications

  • Sequencing strategies:

    • Next-generation sequencing approaches for highly degraded samples

    • Cloning of PCR products to resolve mixed templates

    • Targeted enrichment of mitochondrial sequences prior to sequencing

For optimal results with challenging samples, researchers should consider a sensitivity threshold similar to that reported for other tick markers (1.4-1.9 pg/μl) and adjust protocols accordingly.

How might COII sequences contribute to understanding the vector competence of R. sanguineus for different pathogens?

COII sequence analysis can contribute to vector competence studies in several ways:

  • Lineage-specific vector competence:

    • Different genetic lineages of R. sanguineus may have varying capacities to transmit pathogens

    • COII sequences can help identify which specific lineages are involved in disease transmission

    • Correlation between genetic lineages and pathogen transmission efficiency can be established

  • Co-evolutionary patterns:

    • COII-based phylogenies can be compared with pathogen phylogenies

    • Evidence of co-evolution may indicate long-term associations and potentially higher vector competence

    • Divergent lineages may show different evolutionary relationships with various pathogens

  • Geographical distribution of competent vectors:

    • Mapping COII haplotypes can identify the distribution of competent vector populations

    • Disease risk models can incorporate genetic data to predict emergence in new areas

    • Changes in vector distribution over time can be tracked through historical samples

This approach is particularly valuable given that R. sanguineus serves as a vector for multiple pathogens, including those causing spotted fever group rickettsioses, babesiosis, ehrlichiosis, and hepatozoonosis .

What are the advantages and limitations of using recombinant COII as a vaccine component against R. sanguineus?

AdvantagesLimitations
Conserved nature: COII is relatively conserved, potentially providing cross-protection against multiple tick lineagesLimited accessibility: As a mitochondrial protein, COII may have limited exposure to host immune system
Critical function: Disrupting cytochrome c oxidase function could impact tick survivalVariable efficacy: Based on studies with other tick proteins like Bm86, efficacy can vary significantly between tick strains and geographic regions
Established production methods: Recombinant protein production in E. coli is well-establishedConformation challenges: Maintaining native conformation during recombinant expression is difficult
Potential for multi-target vaccines: Could be combined with other antigens for enhanced protectionLimited field validation: Insufficient data on field performance compared to established vaccine antigens

Based on research with other tick vaccines, such as those using Bm86 protein, researchers should anticipate variable efficacy. For example, Bm86-based vaccines have shown different levels of protection against R. microplus, with percent reductions in different parameters ranging from 0-48% .

How can COII data be integrated with other genetic markers for comprehensive phylogenetic analysis of the R. sanguineus complex?

A comprehensive phylogenetic analysis requires systematic integration of multiple markers:

  • Multi-marker approach:

    • Combine COII with other mitochondrial markers (COI, 16S rDNA, 12S rDNA)

    • Include nuclear markers (ITS2, 18S rDNA) for a complete picture

    • Implement appropriate partitioning strategies in phylogenetic analyses

  • Analytical methods:

    • Concatenated analyses with appropriate evolutionary models for each marker

    • Species tree approaches that account for gene tree discordance

    • Network analyses to visualize complex evolutionary relationships including potential hybridization

  • Integration strategies:

    • Use total evidence approaches that combine all available data

    • Implement statistical methods to test for congruence between markers

    • Apply coalescent-based species delimitation using multiple genes

  • Validation approaches:

    • Integrate morphological data with molecular findings

    • Consider ecological, behavioral, and host association data

    • Apply multiple species delimitation methods and compare results

Studies on R. sanguineus have shown that mitochondrial markers (COI and 16S rDNA) typically display similar topologies in phylogenetic analyses, while nuclear markers like ITS2 may show different patterns, highlighting the importance of a multi-marker approach .

What emerging technologies might enhance the study of recombinant COII and its applications?

Several emerging technologies offer promising avenues for advancing COII research:

  • CRISPR-Cas9 applications:

    • Genome editing to validate COII function in ticks

    • Creation of knockout models to assess physiological impacts

    • Development of modified expression systems for improved recombinant production

  • Advanced protein analysis:

    • Cryo-EM for detailed structural analysis of COII in native conformation

    • Hydrogen-deuterium exchange mass spectrometry for protein dynamics

    • Single-molecule techniques to study protein function

  • High-throughput sequencing approaches:

    • Targeted amplicon sequencing for population-level studies

    • Long-read sequencing for complete mitochondrial genomes

    • Environmental DNA (eDNA) methods for tick surveillance

  • Computational advances:

    • Machine learning algorithms for improved species identification

    • Advanced phylogenetic methods that incorporate geographic and ecological data

    • Protein structure prediction to inform vaccine design

These technologies could significantly enhance our understanding of COII's role in tick biology and expand its applications in diagnostics, surveillance, and control strategies.

How might climate change affect the genetic diversity of R. sanguineus as revealed through COII sequence analysis?

Climate change may drive significant changes in R. sanguineus populations that could be detected through COII sequence analysis:

  • Range expansion patterns:

    • COII haplotype tracking can reveal the spread of specific lineages into new areas

    • Sequential sampling over time can document genetic changes in expanding populations

    • Correlation between climate variables and haplotype distribution can inform predictive models

  • Selection pressures:

    • Detection of selective sweeps in COII sequences under changing conditions

    • Identification of adaptive mutations in populations experiencing environmental stress

    • Monitoring changes in genetic diversity indices over time in relation to climate variables

  • Population dynamics:

    • Changes in population structure as previously isolated populations come into contact

    • Potential hybridization between lineages in newly overlapping ranges

    • Bottleneck events followed by expansion in areas becoming newly suitable

  • Host interaction effects:

    • Shift in host preferences detectable through COII population genetics

    • Co-evolution with host species also experiencing range shifts

    • Changes in vector competence for pathogens under new climate regimes

Researchers should consider that tick activity patterns are influenced by climate variables , which could affect sampling results and subsequent genetic analyses.

What standardization efforts are needed to improve comparability of COII data across different research groups?

To enhance data comparability and research reproducibility, the following standardization efforts are recommended:

  • Sequence data standards:

    • Consensus on primer sets and amplified regions for COII

    • Standardized reference sequences for each recognized lineage

    • Complete metadata reporting (collection date, location, host, methods)

  • Analytical pipeline standardization:

    • Agreed-upon sequence alignment methods

    • Standardized evolutionary models for phylogenetic analyses

    • Common thresholds for species delimitation methods

  • Recombinant protein production:

    • Standardized expression systems and conditions

    • Universal quality control metrics for protein purity and activity

    • Shared protocols for functional assays

  • Integrated databases:

    • Centralized repository for COII sequences with associated metadata

    • Curated reference datasets for different tick lineages

    • Integration with existing tick genomic resources

  • Methodological transparency:

    • Complete reporting of sampling methods and environmental conditions

    • Raw data sharing for weather variables and collection parameters

    • Detailed documentation of laboratory protocols and analytical methods

As highlighted by research on tick sampling methodology, providing raw data for weather conditions with every report is essential for allowing reliable future meta-analyses , a principle that should be extended to all aspects of COII research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.