Recombinant Rhipicephalus sanguineus NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Rhipicephalus sanguineus (Brown dog tick) (Ixodes sanguineus)
Target Names
ND3
Target Protein Sequence
MIFYLHITIFLVVCLLMMLFFSLGFQGKKAKEKNSPFECGFDPFSLSRVPFSLKFFFVGI VFLIFDVEIVVILPFPLVMMTKNLMFVFSFTFINFLIVLGLLYEFKYSMLDRLK
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be a component of the minimal assembly required for catalysis. Complex I facilitates the transfer of electrons from NADH to the respiratory chain, with ubiquinone thought to be the enzyme's immediate electron acceptor.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

How does ND3 structure and function compare between Rhipicephalus species?

Functionally, ND3 appears to serve similar roles across Rhipicephalus species, although species-specific differences in expression patterns or post-translational modifications may influence its activity. Research has demonstrated that disruption of electron transport chain components in different Rhipicephalus species produces comparable but not identical phenotypic effects on tick survival, feeding, and reproduction, suggesting some degree of functional divergence . These differences may relate to adaptations to diverse host preferences and ecological niches.

What are the optimized technical approaches for initial characterization of recombinant ND3?

Initial characterization of recombinant ND3 requires specialized approaches due to its hydrophobic nature and mitochondrial localization:

  • Expression optimization: Using E. coli strains specifically designed for membrane proteins (C41/C43) with expression at reduced temperatures (16-20°C) to enhance proper folding. Including fusion partners like SUMO or MBP tags improves solubility.

  • Purification strategy: Employing mild detergents (n-dodecyl-β-D-maltoside or CHAPS) for extraction, followed by immobilized metal affinity chromatography and size exclusion chromatography for purification.

  • Functional verification: Assessing electron transfer activity using NADH oxidation assays in reconstituted proteoliposome systems containing the purified protein.

  • Structural characterization: Circular dichroism spectroscopy to confirm secondary structure composition, followed by more detailed structural analysis using techniques adapted for membrane proteins.

  • Antibody production: Generating specific antibodies against recombinant ND3 for immunolocalization and protein detection studies.

Expected yields typically range from 0.5-2 mg/L of culture medium, with protein identity confirmed through mass spectrometry and Western blotting with anti-His tag antibodies or custom ND3 antibodies.

How can RNA interference (RNAi) be effectively employed to study ND3 function in Rhipicephalus ticks?

RNA interference provides a powerful approach for functional analysis of ND3 in Rhipicephalus ticks, requiring careful experimental design:

  • dsRNA design: Target unique regions of the ND3 transcript to minimize off-target effects. Design at least two non-overlapping dsRNAs (300-400 bp) targeting different regions of the mRNA.

  • dsRNA synthesis and delivery: Synthesize dsRNA using in vitro transcription with T7 RNA polymerase. Inject approximately 0.3 μl of dsRNA (5 × 10^10 molecules per microliter) into the lower right quadrant of the tick's ventral exoskeleton using a Hamilton syringe with a 33-gauge needle .

  • Control groups: Include both uninjected ticks and ticks injected with unrelated dsRNA (such as GIII dsRNA) as controls to distinguish specific effects from injection trauma or general RNAi responses .

  • Experimental design: Use a minimum of 30 ticks per treatment group to ensure statistical power. Monitor ticks at regular intervals post-injection to capture the temporal dynamics of phenotypic effects .

  • Validation of silencing: Confirm ND3 knockdown efficiency using RT-PCR or qRT-PCR, with successful silencing typically defined as 75-100% reduction in target mRNA levels .

  • Phenotypic assessment: Evaluate multiple parameters including tick attachment success, feeding duration, engorgement weight, mortality rates, and reproductive output (egg mass weight, egg hatching).

ParameterAssessment MethodTypical Timeframe
Gene silencingRT-PCR/qRT-PCR2-7 days post-injection
Attachment successVisual observation24-48 hours post-infestation
EngorgementWeight measurement7-10 days post-infestation
MortalitySurvival countThroughout feeding period
ReproductionEgg mass weight7-14 days post-detachment

What experimental design considerations are crucial when evaluating ND3 as a potential vaccine candidate?

Evaluating ND3 as a vaccine candidate requires rigorous experimental design:

  • Antigen preparation approaches:

    • Recombinant full-length protein expression (challenging due to hydrophobicity)

    • Selected epitope expression as synthetic peptides or recombinant fragments

    • DNA vaccination encoding ND3 or selected epitopes

    • Chimeric constructs incorporating ND3 epitopes with carrier proteins

  • Immunization protocol design:

    • Group size: Minimum 5-10 animals per group for adequate statistical power

    • Control groups: Include adjuvant-only, unrelated antigen, and untreated controls

    • Dosage optimization: Test multiple antigen concentrations (typically 50-200 μg/dose)

    • Administration schedule: Primary immunization plus 1-2 boosters at 2-4 week intervals

    • Sampling timeline: Pre-immunization, post-primary, post-booster, and post-challenge

  • Challenge protocol standardization:

    • Use laboratory-reared R. sanguineus with known feeding parameters

    • Apply standardized tick numbers (typically 25-50 per animal)

    • Utilize containment chambers to restrict tick feeding to specific sites

    • Monitor ticks daily throughout feeding period

  • Evaluation parameters:

    • Immunological: Antibody titers (ELISA), antibody isotypes, cellular responses

    • Tick biological parameters: Attachment rates, feeding success, engorgement weights

    • Reproductive parameters: Egg mass weight, egg viability, molting success

    • Statistical analysis: ANOVA or mixed models with appropriate post-hoc tests

This design facilitates comprehensive assessment of both the immune response generated against ND3 and its actual protective efficacy against tick infestation.

How should researchers address potential off-target effects when interpreting RNAi results for ND3?

Addressing off-target effects is essential for accurate interpretation of RNAi results:

  • In silico prediction:

    • Perform BLAST searches of dsRNA sequences against the tick transcriptome

    • Identify transcripts with ≥16-19 consecutive nucleotide matches

    • Use specialized tools (e.g., dsCheck, E-RNAi) for comprehensive off-target prediction

  • Multiple dsRNA approach:

    • Design and test at least two non-overlapping dsRNAs targeting different regions of ND3

    • Compare phenotypic outcomes across different dsRNAs

    • Consistent effects across different dsRNAs significantly increase confidence in specificity

  • Dose optimization:

    • Establish dose-response relationships by testing multiple dsRNA concentrations

    • Identify the minimum effective dose that produces specific phenotypes

    • Non-linear responses may indicate off-target effects at higher concentrations

  • Transcriptomic validation:

    • Perform targeted qRT-PCR of predicted off-target transcripts

    • Consider genome-wide expression profiling via RNA-Seq after ND3 knockdown

    • Distinguish direct off-target effects from downstream consequences of ND3 silencing

  • Control selection:

    • Include non-targeting dsRNA controls (e.g., GFP, luciferase) to account for sequence-independent effects

    • Use closely related but functionally distinct genes as controls to evaluate specificity

How can comparative functional studies between ND3 and other mitochondrial proteins enhance understanding of tick energy metabolism?

Comparative functional studies of ND3 alongside other mitochondrial proteins provide crucial insights into tick-specific energy metabolism:

  • Complex I component interactions:

    • Simultaneous or sequential silencing of multiple Complex I components

    • Analysis of compensatory expression changes among related proteins

    • Identification of rate-limiting steps in electron transport specific to ticks

  • Functional metabolomics approach:

    • Metabolite profiling following ND3 silencing compared to other mitochondrial targets

    • Flux analysis using isotope-labeled substrates to track metabolic pathway alterations

    • Identification of tick-specific metabolic adaptations and potential intervention points

  • Tissue-specific functional variation:

    • Comparative analysis of ND3 function across different tick tissues (salivary glands, midgut, ovaries)

    • Tissue-specific knockdown using localized RNAi delivery methods

    • Correlation of tissue-specific effects with metabolic demands during feeding and reproduction

  • Evolutionary adaptation assessment:

    • Cross-species functional comparison of homologous proteins

    • Correlation of functional differences with feeding strategies or host preferences

    • Identification of conserved vs. species-specific aspects of mitochondrial function

A comprehensive approach should integrate physiological measurements (oxygen consumption, ATP production) with molecular analyses (protein expression, activity assays) and metabolic profiling. This multi-level analysis reveals how ND3 contributes to tick-specific adaptations in energy metabolism, potentially identifying unique vulnerabilities for targeted intervention .

What approaches can be used to investigate the potential role of ND3 in reactive oxygen species (ROS) production in tick mitochondria?

Investigating ND3's role in ROS production requires specialized approaches adapted from mammalian studies:

  • ROS detection methodologies:

    • Fluorescent probes: MitoSOX Red for mitochondrial superoxide detection

    • Chemiluminescent assays: Lucigenin-enhanced chemiluminescence for quantification

    • Electron paramagnetic resonance (EPR) spectroscopy for definitive ROS species identification

  • Experimental manipulation approaches:

    • ND3 silencing: Measure ROS production before and after RNAi-mediated knockdown

    • Site-directed mutagenesis: Introduce mutations at sites homologous to known ROS-affecting residues

    • Inhibitor studies: Compare effects of Complex I inhibitors with varying mechanisms

  • Structure-function analysis:

    • Identify ND3 domains potentially involved in ROS production by sequence comparison

    • Map mutations or modifications that alter ROS production to structural models

    • Correlate structural features with functional outputs

  • Physiological relevance assessment:

    • Measure ROS production under conditions mimicking feeding, molting, or environmental stress

    • Correlate changes in ROS levels with phenotypic effects of ND3 manipulation

    • Assess consequences of altered ROS production on tick longevity and fecundity

Based on research in mammalian systems, Complex I produces primarily superoxide rather than hydrogen peroxide, with fully reduced flavin serving as the electron donor to O₂ . The rate of superoxide production is determined by a bimolecular reaction between O₂ and reduced flavin, influenced by the NADH/NAD⁺ ratio . Researchers should investigate whether similar mechanisms operate in tick mitochondria and how ND3 variants might modulate this process.

How can proteomic approaches complement genomic studies of ND3 and related proteins?

Proteomic approaches provide critical insights that complement genomic studies of ND3:

  • Post-translational modification analysis:

    • Phosphoproteomic analysis to identify regulatory phosphorylation sites

    • Redox proteomics to detect oxidative modifications affecting function

    • Mass spectrometry-based mapping of other modifications (acetylation, glycosylation)

  • Protein-protein interaction networks:

    • Co-immunoprecipitation coupled with mass spectrometry to identify interaction partners

    • Proximity labeling techniques (BioID, APEX) to map the ND3 interaction landscape

    • Blue native PAGE analysis to study intact Complex I architecture and assembly

  • Protein turnover and dynamics:

    • Pulse-chase experiments with stable isotope labeling to determine protein half-life

    • Thermal shift assays to evaluate protein stability under different conditions

    • Hydrogen-deuterium exchange mass spectrometry to assess conformational dynamics

  • Functional proteomics:

    • Activity-based protein profiling to assess ND3 functional state

    • Comparative proteomics between different physiological states or tick strains

    • Quantitative analysis of compensatory protein expression changes

  • Structural proteomics:

    • Cross-linking mass spectrometry to map protein topology within Complex I

    • Limited proteolysis combined with mass spectrometry to identify flexible regions

    • Ion mobility mass spectrometry for insights into 3D structure

These approaches reveal functional aspects of ND3 not evident from sequence data alone, providing a more complete understanding of its role in tick physiology and its potential as a target for intervention strategies.

What statistical approaches are most appropriate for analyzing phenotypic effects following ND3 silencing in ticks?

  • Experimental design considerations:

    • Power analysis to determine adequate sample size (typically 30 ticks per group for RNAi)

    • Randomization procedures to minimize bias

    • Inclusion of appropriate controls (uninjected and irrelevant dsRNA-injected)

  • For binary outcomes (survival, attachment):

    • Chi-square or Fisher's exact tests for comparing proportions

    • Logistic regression when accounting for covariates

    • Kaplan-Meier survival analysis with log-rank tests for time-to-event data

  • For continuous outcomes (weights, oviposition):

    • Normality testing to determine appropriate parametric or non-parametric approaches

    • Student's t-test or Mann-Whitney U test for two-group comparisons

    • ANOVA or Kruskal-Wallis with post-hoc tests for multiple group comparisons

  • For time-series data (feeding progression, gene expression):

    • Repeated measures ANOVA or mixed-effects models

    • Area under the curve (AUC) analysis to compare temporal profiles

    • Growth curve modeling for developmental parameters

  • Effect size reporting:

    • Calculate and report effect sizes (Cohen's d, percent reduction) alongside p-values

    • Provide confidence intervals for all estimates

    • Use standardized reporting formats to facilitate meta-analysis

Example data table format for reporting RNAi phenotypic effects:

ParameterControl Group (Mean ± SD)ND3 dsRNA Group (Mean ± SD)Percent Changep-valueEffect Size (Cohen's d)
Attachment rate91% ± 5%62% ± 8%-31.9%<0.011.82
Engorgement weight255 ± 28 mg176 ± 22 mg-31.0%<0.0012.14
Egg mass weight118 ± 12 mg72 ± 15 mg-39.0%<0.0011.95

How should researchers plan comparative studies of ND3 across different Rhipicephalus species?

Planning comparative studies of ND3 across Rhipicephalus species requires systematic approaches:

Example comparative analysis framework:

Analysis LevelParameters to CompareAnalytical Approach
SequenceAmino acid identity, conserved motifsMultiple sequence alignment, conservation scoring
ExpressionTissue distribution, developmental timingqRT-PCR with universal primers, normalized to conserved reference genes
RNAi efficacyKnockdown efficiency, durabilitySpecies-specific qRT-PCR assays
Phenotypic effectsAttachment, feeding, reproductionStandardized bioassays with statistical correction for species baselines
Biochemical functionElectron transport activity, ROS productionIsolated mitochondria assays with species-specific calibration

What are the key considerations for designing experiments to study ND3 as part of a multi-antigen vaccine approach?

Designing experiments for ND3-containing multi-antigen vaccines requires careful planning:

  • Antigen selection strategy:

    • Functional complementarity: Combine ND3 with antigens targeting different biological processes

    • Expression pattern diversity: Include antigens expressed at different feeding stages

    • Localization diversity: Combine antigens from different tick tissues/cellular locations

    • Immunogenicity balance: Select antigens with complementary immunogenic properties

  • Formulation development:

    • Antigen ratio optimization: Test multiple proportions to identify optimal combinations

    • Adjuvant compatibility: Ensure selected adjuvant enhances immune response to all antigens

    • Delivery system: Consider polyvalent constructs vs. antigen mixtures

    • Stability assessment: Evaluate stability of combined antigens in the chosen formulation

  • Immunological evaluation design:

    • Antibody profiling: Measure responses to each component individually within the cocktail

    • Epitope analysis: Ensure immunodominant epitopes remain accessible in combinations

    • Cellular immunity: Assess T-cell responses to combined formulations

    • Cross-reactivity: Test for unexpected cross-reactive immune responses

  • Challenge study design:

    • Factorial design to test individual antigens and combinations systematically

    • Multiple parameter assessment: Attachment, feeding, reproduction

    • Sequential challenges: Test protection against initial and subsequent infestations

    • Long-term protection: Extended monitoring to determine duration of immunity

Example experimental design matrix for a multi-antigen approach including ND3:

GroupAntigensDose (μg/antigen)AdjuvantNumber of AnimalsChallenge Protocol
1ND3100Alum1050 adult ticks, day 28 post-boost
2Antigen X100Alum1050 adult ticks, day 28 post-boost
3Antigen Y100Alum1050 adult ticks, day 28 post-boost
4ND3 + X100 eachAlum1050 adult ticks, day 28 post-boost
5ND3 + Y100 eachAlum1050 adult ticks, day 28 post-boost
6X + Y100 eachAlum1050 adult ticks, day 28 post-boost
7ND3 + X + Y100 eachAlum1050 adult ticks, day 28 post-boost
8Adjuvant only-Alum1050 adult ticks, day 28 post-boost

This design enables assessment of individual contributions and synergistic effects when ND3 is combined with other antigens .

What emerging technologies might enhance our understanding of ND3 function in tick physiology?

Several emerging technologies hold promise for advancing ND3 research:

  • CRISPR-Cas9 gene editing in ticks:

    • Generation of precise ND3 knockout or knock-in mutations

    • Conditional knockout systems to study tissue-specific functions

    • Base editing for introducing specific point mutations to study structure-function relationships

    • CRISPR interference (CRISPRi) for titratable gene repression

  • Single-cell and spatial technologies:

    • Single-cell RNA-Seq to map ND3 expression heterogeneity across tick tissues

    • Spatial transcriptomics to visualize expression patterns within intact tissues

    • Single-cell proteomics to detect cell-type-specific variations in protein levels

    • In situ sequencing for spatial mapping of ND3 expression at subcellular resolution

  • Advanced imaging approaches:

    • Super-resolution microscopy for visualizing ND3 distribution within mitochondria

    • Correlative light and electron microscopy (CLEM) to connect molecular localization with ultrastructure

    • Live-cell imaging using split fluorescent proteins to track dynamic interactions

    • Multiplexed ion beam imaging (MIBI) for simultaneous visualization of multiple proteins

  • Systems biology integration:

    • Multi-omics data integration to place ND3 in broader metabolic networks

    • Metabolic flux analysis using stable isotope tracers

    • Network medicine approaches to identify non-obvious relationships

    • Computational modeling of respiratory chain dynamics with variable ND3 parameters

These technological advances could overcome current limitations in tick research, enabling more precise manipulation of ND3 and more comprehensive analysis of its functions in tick physiology, ultimately accelerating the development of novel control strategies.

How might interdisciplinary approaches enhance the translation of ND3 research into practical applications?

Interdisciplinary approaches are essential for translating ND3 research into practical tick control applications:

  • Collaborative research frameworks:

    • Molecular biologists and parasitologists: For mechanistic characterization

    • Immunologists and vaccinologists: For effective delivery systems

    • Ecologists and epidemiologists: For field efficacy assessment

    • Computational biologists: For predicting population-level impacts

  • Technology integration approaches:

    • Nanotechnology: Develop nanoparticle-based delivery systems

    • Synthetic biology: Engineer microorganisms to express anti-ND3 molecules

    • Biomaterial science: Create sustained-release formulations

    • Remote sensing: Optimize intervention timing and location

  • Implementation science considerations:

    • Cost-effectiveness analysis comparing ND3-based interventions with existing methods

    • Stakeholder engagement involving livestock owners and public health agencies

    • Regulatory pathway mapping to address potential hurdles for novel interventions

    • Knowledge translation strategies for diverse end-users

  • Translational research pipeline:

    • Systematic progression from laboratory validation to field implementation

    • Parallel development of implementation tools alongside basic research

    • Iterative refinement based on field feedback

This interdisciplinary approach bridges the gap between laboratory discoveries and practical applications, ensuring that advances in ND3 research are effectively translated into tools for tick management in real-world settings .

What approaches can address the challenges of studying membrane proteins like ND3 in structural and functional assays?

Addressing the challenges of working with membrane proteins like ND3 requires specialized approaches:

  • Structural characterization strategies:

    • Lipidic cubic phase (LCP) crystallization methods optimized for membrane proteins

    • Cryo-electron microscopy (cryo-EM) for structure determination without crystallization

    • Computational approaches combining homology modeling with molecular dynamics simulations

    • Hybrid methods integrating low-resolution experimental data with computational models

  • Expression and purification optimization:

    • Cell-free systems with membrane-mimetic environments

    • Specialized fusion partners (MISTIC, Mistic) for improved membrane protein expression

    • Systematic detergent screening to identify optimal extraction conditions

    • Reconstitution into nanodiscs or amphipols for stable, native-like environments

  • Functional assay adaptations:

    • Proteoliposome reconstitution systems for functional studies

    • Development of specialized activity assays for reconstituted systems

    • Membrane potential monitoring using potential-sensitive dyes

    • Patch-clamp electrophysiology for detailed biophysical characterization

  • Interaction studies approaches:

    • Chemical cross-linking mass spectrometry for capturing transient interactions

    • Hydrogen-deuterium exchange mass spectrometry for probing conformational dynamics

    • Surface plasmon resonance with specialized sensor chips for membrane protein interactions

    • Microscale thermophoresis for quantifying interactions with minimal material requirements

These specialized approaches help overcome the inherent difficulties of working with membrane proteins like ND3, enabling more comprehensive structural and functional characterization to inform the development of targeted interventions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.