Recombinant Rhizobium etli Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rhizobium etli Lnt

Recombinant Rhizobium etli Lnt is a full-length, His-tagged protein (UniProt ID: B3PZB2) expressed in Escherichia coli. It spans 534 amino acids and is purified to >90% purity via SDS-PAGE . Key characteristics include:

PropertyDetails
Host OrganismRhizobium etli (strain CIAT 652)
Expression SystemE. coli
TagN-terminal His tag
Molecular FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
ReconstitutionSterile water (0.1–1.0 mg/mL) with optional glycerol for stability

Enzymatic Role

Lnt transfers an acyl group from phospholipids to the N-terminus of apolipoproteins, converting diacylated lipoproteins into triacylated forms. This modification is essential for:

  • Membrane anchoring of lipoproteins in Gram-negative bacteria .

  • Toll-like receptor (TLR) activation, influencing host immune responses .

Research Applications

Recombinant Rhizobium etli Lnt is utilized in:

  1. Enzymatic Assays: Studying acyltransferase kinetics and substrate specificity.

  2. Structural Biology: Crystallization trials to resolve conformational changes .

  3. Immunoassays: Available as an ELISA-ready antigen (1,899.00 € per 50 µg) .

Comparative Analysis of Lnt Activity

OrganismSubstrate SpecificityLipoprotein Modification
Rhizobium etliNot fully characterizedAssumed triacylation
Mycobacterium tuberculosisC16 fatty acid (N-acylation)Triacylated (C16, C16, C19:0)
Escherichia coliPhospholipid-derived acyl groupsTriacylated (C16 predominates)

Key Research Findings

  • Broad Phylogenetic Distribution: Lnt homologs exist in Gram-positive actinomycetes (e.g., Mycobacterium), challenging earlier assumptions of Gram-negative exclusivity .

  • Biotechnological Relevance: Recombinant Lnt enables large-scale lipoprotein production for vaccine development and pathogenicity studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirement.
Lead Time
Delivery time may vary based on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lnt; RHECIAT_CH0000412; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-534
Protein Length
full length protein
Species
Rhizobium etli (strain CIAT 652)
Target Names
lnt
Target Protein Sequence
MERLADRVILVWGFKRSLLAIGAGAFAVLALPPFGFFAAMFLSFTLLVWLIDGAAASPES GLIGRLWPAFAVGWLFGFGYFVAGLWWLGHALLVDSEEFAWALPLAILGLPACLAIFYGL AVALARIFWSDGMGRIAALAAGFGLMEWLRSVILTGFPWNAIGYGLMPVPLMMQSAHVIG AMGVTALAVFVFSAPALFGTRQGARTGVALAVLLFAAHLGYGAYALYLAPRPAPLPEDKR PVVRLVQPDIDQAAKMDNDADRNAIFETHLKLSAEAPRNGGRKPNIIVWPETSIPFILTD NQDALTRIADTLDDDQILIAGAVRAEEMGPGTPVRYYNSIYVIDGRGQIIAASDKVHLVP FGEYLPLEELLTELGIQNVVEVPGGFSAAASRHLLALPGGLNLYPLICYEIIFPDEMTGD IKDANALLNLTNDAWFGMTPGPYQHFLQARVRAVETGLPLIRDANSGISALVNAHGEIIA GLDLGETGFIDATVDSLSEGFGSTYPRQTYFWLTEALLILIALISREGFIFGLN
Uniprot No.

Target Background

Function
Catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, the final step in lipoprotein maturation.
Database Links
Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Apolipoprotein N-acyltransferase (lnt) and what role does it play in Rhizobium etli?

Apolipoprotein N-acyltransferase (lnt) is an integral membrane enzyme that catalyzes the final step in bacterial lipoprotein maturation. In Rhizobium etli, as in other Gram-negative bacteria, lnt performs the N-acylation of the terminal cysteine residue of apolipoproteins to form mature lipoproteins . This post-translational modification is crucial for proper lipoprotein function within the bacterial cell envelope. Rhizobium etli is a Gram-negative soil-dwelling alphaproteobacterium that engages in symbiotic nitrogen fixation with leguminous plants, particularly beans (Phaseolus vulgaris) . The proper functioning of lipoproteins, processed by lnt, is essential for maintaining membrane integrity and supporting various cellular processes including symbiotic interactions.

What are the structural characteristics of Rhizobium etli lnt protein?

Rhizobium etli lnt is characterized by several key structural features:

  • The full amino acid sequence includes approximately 534 amino acids as indicated in some recombinant products

  • The protein contains multiple transmembrane domains that anchor it within the bacterial membrane

  • Its active site includes a catalytic cysteine residue that forms a thioester acyl-intermediate during the reaction mechanism

  • The enzyme undergoes significant conformational changes during catalysis, featuring a dynamic arm that can restrict access to the active site

  • The protein possesses regions of structural similarity to other acyltransferases in the nitrilase superfamily

While specific crystallographic data for R. etli lnt is not provided in the search results, structural studies of homologous lnt from E. coli reveal that the enzyme can exist in both "open" and "closed" conformations, which likely has implications for substrate binding and catalytic activity .

What expression systems are most effective for producing recombinant Rhizobium etli lnt?

Based on commercially available recombinant proteins and research protocols:

E. coli expression systems are predominantly used for recombinant lnt production . This heterologous expression approach offers several advantages:

  • High-yield protein production

  • Well-established induction protocols

  • Compatible with various fusion tags to facilitate purification

  • Ability to express membrane proteins through specialized strains

The expression methodology should include:

  • Selection of an appropriate E. coli strain (BL21(DE3), C41/C43, or Rosetta for rare codon optimization)

  • Optimization of induction conditions (IPTG concentration, temperature, and duration)

  • Use of a vector containing appropriate promoter elements (T7 or tac) and fusion tags determined during the production process

  • Implementation of membrane protein expression strategies (reduced induction temperature of 16-25°C, addition of glucose to reduce basal expression)

For researchers working with this challenging membrane protein, it is advisable to try several expression constructs with different solubility-enhancing tags (MBP, SUMO, or thioredoxin) to improve folding and stability.

What purification strategies yield the highest purity and activity of recombinant Rhizobium etli lnt?

A multi-step purification approach is recommended for obtaining high-purity, active lnt:

  • Initial extraction using mild detergents (DDM, LDAO, or Triton X-100) to solubilize the membrane protein while maintaining native conformation

  • Affinity chromatography using an appropriate tag system (His-tag, GST, etc.) as determined during the production process

  • Size exclusion chromatography to eliminate aggregates and improve homogeneity

  • Optional ion exchange chromatography for removing contaminating proteins

The purification protocol should consider:

  • Maintaining the protein in appropriate buffer conditions with stabilizing agents (glycerol at 50% for long-term storage)

  • Temperature control throughout the process (4°C recommended for working aliquots)

  • Addition of reducing agents (DTT or β-mercaptoethanol) to protect the catalytic cysteine from oxidation

  • Optimizing detergent concentration to maintain protein solubility without destabilizing the native structure

For optimal results, the final purified protein should achieve >85% purity as assessed by SDS-PAGE , with storage recommendations including aliquoting to avoid freeze-thaw cycles that can compromise activity.

What are the optimal storage conditions for maintaining recombinant Rhizobium etli lnt activity?

Based on commercial protein guidelines:

The stability and shelf life of recombinant lnt is influenced by multiple factors including buffer composition, storage temperature, and protein concentration. The following recommendations maximize enzyme stability:

  • Short-term storage (up to one week): 4°C in appropriate buffer

  • Long-term storage: -20°C or -80°C with 50% glycerol as a cryoprotectant

  • Lyophilized form has extended shelf life (approximately 12 months at -20°C/-80°C)

  • Liquid preparations typically maintain stability for about 6 months at -20°C/-80°C

Important considerations include:

  • Avoid repeated freeze-thaw cycles as they significantly reduce enzyme activity

  • Store in small working aliquots to minimize thawing events

  • Ensure buffer conditions contain stabilizing components like glycerol

  • Consider protein concentration (0.1-1.0 mg/mL recommended for reconstitution)

  • Briefly centrifuge vials before opening to bring contents to the bottom

Researchers should validate enzyme activity after extended storage periods using appropriate activity assays.

What methods can be used to measure the enzymatic activity of Rhizobium etli lnt in vitro?

Several complementary approaches can be employed to assess lnt activity:

  • Direct acyltransferase activity assay:

    • Using synthetic apolipoprotein substrates or peptides containing the lipobox motif

    • Monitoring the transfer of fatty acids from phospholipid donors to the N-terminal cysteine

    • Quantification via HPLC, mass spectrometry, or radioactive labeling

  • Structural confirmation of acyl-enzyme intermediate:

    • Mass spectrometric analysis to detect the thioester acyl-intermediate formed at the catalytic cysteine

    • X-ray crystallography to visualize the covalent modification of the active site

  • Conformational change assessment:

    • Monitoring the transition between open and closed conformations using fluorescence-based techniques

    • Analyzing mobility shifts in native PAGE conditions with various substrates

  • Comparative enzymatic analysis:

    • Parallel testing with E. coli lnt as a reference standard

    • Site-directed mutagenesis of key catalytic residues to establish structure-function relationships

For quantitative assessment, researchers should establish a standardized assay under defined reaction conditions (pH, temperature, substrate concentration) and include appropriate controls for non-enzymatic acylation.

How do conformational changes affect the catalytic mechanism of Rhizobium etli lnt?

Structural studies of homologous lnt proteins reveal important insights applicable to R. etli lnt:

The enzyme exhibits significant conformational flexibility that is integral to its catalytic mechanism . Based on crystallographic data from E. coli lnt, at least two distinct conformational states exist:

  • Closed conformation:

    • Features a highly dynamic arm that restricts access to the active site

    • Contains a covalent modification at the active site cysteine consistent with the thioester acyl-intermediate

    • Likely represents the catalytically engaged state during acyl transfer

  • Open conformation:

    • Exposes the active site to the environment

    • Facilitates substrate binding and product release

    • May represent the state that receives the incoming apolipoprotein substrate

These conformational changes appear to control substrate access and product release through the movement of essential loops and residues that are triggered by substrate binding . The dynamic nature of these conformational shifts is crucial for:

  • Proper positioning of catalytic residues

  • Regulation of the sequential transfer of acyl groups

  • Control of the interaction between lnt and the incoming substrate apolipoprotein

Understanding these dynamics provides critical context for interpreting residues shown to be essential for lnt function and offers insights into potential mechanisms of inhibition or regulation.

What role does lnt play in membrane integrity and stress response in Rhizobium etli?

While specific data for R. etli lnt is limited in the search results, comparative studies with related rhizobial species provide valuable insights:

In Rhizobium leguminosarum, mutations affecting lipid A synthesis and modification (which is linked to lipoprotein processing) result in compromised membrane integrity, including:

  • Increased sensitivity to detergents (deoxycholate and dodecyl sulfate)

  • Greater susceptibility to antimicrobial peptides like polymyxin B

  • Reduced tolerance to elevated salt concentrations

By extension, proper functioning of lnt in R. etli likely contributes to:

  • Maintenance of outer membrane stability through correct processing of lipoproteins

  • Protection against environmental stresses including osmotic challenges

  • Resistance to antimicrobial compounds encountered in soil environments

  • Support of symbiotic interactions with host plants

The importance of these functions is underscored by observations that membrane integrity defects in rhizobial strains can be partially restored following plant passage , suggesting host-specific adaptations in lipoprotein processing.

How does lnt function contribute to Rhizobium-legume symbiosis?

The symbiotic relationship between Rhizobium etli and legumes, particularly Phaseolus vulgaris (common bean), depends on properly functioning bacterial membrane components:

Research with related rhizobial species demonstrates that mutations affecting membrane lipid composition and lipoprotein processing impact symbiotic development:

  • Mutants show developmental delays during symbiotic infection of host plants

  • Abnormal symbiosome structures can form when membrane components are improperly processed

  • The ability to fix nitrogen efficiently may be compromised by membrane defects

The functional importance of lnt in this context likely includes:

  • Maintaining membrane integrity during plant infection processes

  • Supporting proper bacteroid development within plant nodules

  • Contributing to stress resistance during the transition from soil to plant environment

  • Enabling appropriate signaling between bacteria and host plants

Importantly, the geographical structuring and sequence divergence observed in R. etli strains may affect lnt functionality across different isolates, potentially influencing symbiotic outcomes with various host plants.

How can site-directed mutagenesis be used to investigate structure-function relationships in Rhizobium etli lnt?

Site-directed mutagenesis represents a powerful approach for elucidating key functional elements of R. etli lnt:

Recommended methodology:

  • Target selection based on structural homology:

    • Identify conserved catalytic residues by alignment with E. coli lnt

    • Focus on the catalytic triad (typically including the essential cysteine)

    • Target residues involved in conformational changes and substrate binding

  • Mutagenesis strategy:

    • Generate alanine substitutions to assess general importance of residues

    • Create conservative substitutions to probe specific chemical properties

    • Design mutations that lock the enzyme in open or closed conformations

  • Functional assessment:

    • Express and purify mutant proteins using standardized protocols

    • Compare enzymatic activity using quantitative assays

    • Assess structural integrity through circular dichroism or thermal stability assays

    • Evaluate membrane association properties

  • Data interpretation framework:

    • Classify mutations as affecting substrate binding, catalysis, or protein stability

    • Map results onto homology models based on E. coli lnt crystallographic data

    • Correlate findings with known conformational states (open/closed)

This approach can reveal residues critical for:

  • Catalytic mechanism and thioester intermediate formation

  • Substrate specificity differences between Rhizobium and other bacterial species

  • Conformational transitions required for enzyme function

  • Membrane association and topological orientation

What comparative genomic approaches can provide insights into lnt evolution across Rhizobium species?

Comparative genomic analysis offers valuable evolutionary insights:

Methodological approach:

  • Sequence collection and alignment:

    • Gather lnt sequences from diverse Rhizobium species and strains

    • Include sequences from related genera within the Rhizobiaceae family

    • Perform multiple sequence alignment using MUSCLE or T-Coffee algorithms

  • Phylogenetic analysis:

    • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Root trees with appropriate outgroups from more distant bacterial lineages

    • Assess topology support through bootstrap or posterior probability values

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify sites under purifying or positive selection

    • Apply site-specific models to detect variation in selection across the protein

    • Correlate selection patterns with structural domains and functional regions

  • Genomic context analysis:

    • Examine conservation of gene neighborhood across species

    • Identify potential operon structures or co-evolved gene clusters

    • Investigate horizontal gene transfer events through compositional bias analysis

This approach can address key questions:

  • Has lnt evolved primarily under purifying selection, suggesting essential function?

  • Are there specific domains showing accelerated evolution in certain lineages?

  • Does lnt evolution correlate with host plant specificity or geographical distribution?

  • Has the genomic context of lnt remained stable throughout Rhizobium evolution?

When applying these methods to R. etli specifically, researchers should consider the known geographic structuring and sequence divergence patterns that may reflect adaptation to local environmental conditions or host plants.

How does Rhizobium etli lnt compare structurally and functionally with homologs from other bacteria?

Comparative analysis reveals both conservation and specialization:

Structural comparison:

FeatureR. etli lntE. coli lntOther Gram-negative bacteria
Protein size~534 amino acids Similar lengthVariable but conserved core
Membrane topologyMultiple transmembrane domainsSimilar topologyGenerally conserved
Catalytic residuesConserved cysteine and other catalytic residuesWell-characterized catalytic triadHighly conserved
Conformational statesLikely exhibits open/closed conformationsDocumented open/closed transitions Similar dynamics expected
Substrate binding pocketMay reflect specificity for rhizobial lipoproteinsCharacterized for E. coli substratesVariable regions correlate with substrate preference

Functional comparison:

  • Catalytic mechanism:

    • Core N-acyltransferase activity is conserved across species

    • The thioester acyl-intermediate formation mechanism appears universal

    • Differences may exist in substrate specificity and regulatory mechanisms

  • Physiological context:

    • In R. etli: Supports symbiotic nitrogen fixation and plant interaction

    • In E. coli: Primarily maintains cell envelope integrity

    • In pathogens: Often contributes to virulence and host interaction

  • Evolutionary significance:

    • lnt is specific to Gram-negative bacteria

    • The enzyme likely evolved with the development of the outer membrane

    • Specialized features in R. etli may reflect adaptation to plant-associated lifestyle

This comparative framework provides a basis for understanding how lnt function has been tailored to specific bacterial lifestyles while maintaining core enzymatic activity.

What are common challenges in working with recombinant Rhizobium etli lnt and how can they be addressed?

Researchers working with recombinant lnt face several technical challenges:

Challenge 1: Low expression yields

  • Problem: As a membrane protein, lnt often expresses poorly in heterologous systems

  • Solutions:

    • Optimize codon usage for expression host

    • Try different fusion tags (MBP, SUMO, TrxA)

    • Reduce expression temperature (16-20°C)

    • Use specialized E. coli strains (C41/C43, Lemo21)

    • Consider cell-free expression systems for difficult constructs

Challenge 2: Protein insolubility and aggregation

  • Problem: Membrane proteins can aggregate during extraction and purification

  • Solutions:

    • Screen multiple detergents (DDM, LDAO, CHAPS) at various concentrations

    • Add stabilizing agents (glycerol, specific lipids) to extraction buffers

    • Incorporate amphipols or nanodiscs for maintaining native-like membrane environment

    • Use on-column refolding protocols if inclusion bodies form

Challenge 3: Loss of activity during purification

  • Problem: Enzymatic activity often decreases during multi-step purification

  • Solutions:

    • Minimize purification steps and processing time

    • Include reducing agents to protect catalytic cysteine

    • Add phospholipids to mimic native membrane environment

    • Avoid harsh elution conditions in affinity chromatography

    • Store with 50% glycerol and avoid freeze-thaw cycles

Challenge 4: Difficulty in activity assessment

  • Problem: Establishing reliable activity assays can be challenging

  • Solutions:

    • Develop synthetic substrate analogs for easier detection

    • Employ mass spectrometry to detect reaction products

    • Use E. coli lnt as positive control and reference standard

    • Include appropriate negative controls (heat-inactivated enzyme, catalytic mutants)

By anticipating and addressing these challenges through methodical optimization, researchers can improve their chances of successfully working with this complex membrane enzyme.

What emerging research areas could advance our understanding of Rhizobium etli lnt?

Several promising directions for future research include:

These research directions build upon current knowledge while expanding into new territories that could yield significant insights into both basic bacterial physiology and applied aspects of plant-microbe interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.