Recombinant Rhizobium etli ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Functional Role in ATP Synthase

ATP synthase subunit a forms part of the F₀ sector, which facilitates proton translocation across membranes to drive ATP synthesis. Key structural and functional insights include:

  • Proton Transport Pathway: Subunit a interacts with the c-ring rotor, enabling proton movement through conserved residues (e.g., Lys-180 in alkaliphilic homologs) .

  • Conformational Dynamics: Cryo-EM studies of related bacterial ATP synthases (e.g., Bacillus PS3) reveal rotational states critical for coupling proton flow to ATP synthesis .

Table 1: Key Research Insights

StudyFindingsSource
Gene KnockdownDepletion of atpB in Rhizobium etli led to reduced ATP synthase activity, impaired respiration, and energy deficits.
Structural AnalysisSubunit a’s transmembrane helices are essential for maintaining proton gradient integrity.
Mutational StudiesLys-180 in alkaliphilic homologs is critical for proton capture and ATP synthesis under low protonmotive force.

Experimental Use Cases

  • Enzyme Reconstitution: Recombinant subunit a is used to study ATP synthase assembly and proton transport kinetics .

  • Functional Complementation: Assays in mutant strains (e.g., Bacillus pseudofirmus) validate roles in ATP synthesis under extreme pH conditions .

Technical Considerations for Use

Best Practices

  • Avoid repeated freeze-thaw cycles to prevent denaturation.

  • Use Tris-based buffers with glycerol for stability .

Implications for Bioenergetics Research

Recombinant Rhizobium etli ATP synthase subunit a serves as a model for:

  • Evolutionary Studies: Comparative analysis with mitochondrial ATP synthase highlights conserved proton transport mechanisms .

  • Biotechnological Engineering: Insights into proton coupling efficiency inform synthetic biology applications .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference for your needs.
Shelf Life
Shelf life is dependent on multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; RHE_CH00864; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Rhizobium etli (strain CFN 42 / ATCC 51251)
Target Names
atpB
Target Protein Sequence
MSNDPTHQFLIQKIVPIEIGGIDFSFTNASLFMAASAAVAAGFLYFSTSNRAIVPGRSQS VAEMSYEFIANMLKEGAGKQGLKFFPLVFSLFMFVLTANLLGMFPYFFTITSQIIVTFAL AILVISTVLIYGFYKHGFHFLNVFVPSGVPGILLPLVVAIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVASLGALGAVGVGGAVLPLIMTVALTGLEFLVAFLQAYVFAVLTCMY LNDAIHPGGH
Uniprot No.

Target Background

Function
As a key component of the proton channel, this protein plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does Rhizobium etli ATP synthase subunit a (atpB) differ from ATP synthase subunits in other organisms?

While the core catalytic mechanism is conserved across species, the Rhizobium etli ATP synthase subunit a exhibits specific structural adaptations that distinguish it from homologous proteins in other organisms. Unlike the ATP synthase in E. coli, which has been extensively characterized, the R. etli variant contains unique amino acid substitutions that may reflect adaptations to the symbiotic lifestyle of this organism.

Bacterial ATP synthases (F-type) differ structurally from V-type ATPases found in eukaryotic vacuolar membranes and A-type ATPases in archaea, though they all utilize a rotary mechanism for energy conversion. The R. etli ATP synthase belongs to the F-type category but contains specific sequence variations that may influence its proton translocation efficiency or regulatory properties in response to the specialized metabolic requirements of this nitrogen-fixing bacterium .

What are the optimal conditions for expressing recombinant Rhizobium etli ATP synthase subunit a (atpB) in heterologous systems?

The optimal expression of recombinant R. etli atpB protein involves several critical parameters:

  • Expression System: E. coli has been successfully used as a heterologous host for expressing the full-length R. etli atpB protein (amino acids 1-250) with an N-terminal His tag .

  • Vector Selection: Vectors containing strong inducible promoters (e.g., T7) are preferable for controlling expression levels.

  • Induction Parameters: The following table outlines optimal induction conditions based on experimental data:

ParameterOptimal ConditionAlternative RangeNotes
Temperature18°C16-22°CLower temperatures reduce inclusion body formation
Inducer (IPTG)0.5 mM0.1-1.0 mMConcentration may need adjustment based on strain
Induction Duration16-18 hours12-24 hoursExtended periods improve yield for membrane proteins
MediaLB with supplementsTB, 2YTRich media enhances expression
OD₆₀₀ at Induction0.6-0.80.4-1.0Mid-log phase typically yields best results
  • Codon Optimization: Due to the differences in codon usage between R. etli and E. coli, codon optimization of the atpB sequence may significantly improve expression efficiency.

What purification strategy yields the highest purity and activity for recombinant Rhizobium etli ATP synthase subunit a (atpB)?

A multi-step purification approach is recommended for obtaining high-purity, functionally active recombinant R. etli atpB protein:

  • Initial Extraction: For membrane proteins like atpB, extraction using mild detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS) is essential for solubilization while maintaining protein structure.

  • Affinity Chromatography: The N-terminal His-tag enables efficient purification using Ni-NTA affinity chromatography .

  • Buffer Optimization: The following buffer composition has proven effective:

    • 50 mM Tris-HCl, pH 8.0

    • 150-300 mM NaCl

    • 5% glycerol

    • 0.05-0.1% appropriate detergent

    • Protease inhibitor cocktail

  • Secondary Purification: Size exclusion chromatography further enhances purity.

  • Quality Assessment: SDS-PAGE analysis should demonstrate >90% purity .

  • Storage: For optimal stability, the purified protein should be stored in buffer containing 6% trehalose at -20°C/-80°C, with aliquoting to avoid repeated freeze-thaw cycles .

How can I assess the proton translocation activity of recombinant Rhizobium etli ATP synthase subunit a (atpB) in vitro?

Proton translocation activity can be assessed through several complementary approaches:

  • Reconstitution into Liposomes: Purified atpB protein should be reconstituted into phospholipid vesicles to create proteoliposomes.

  • pH Gradient Monitoring: Use pH-sensitive fluorescent dyes (e.g., ACMA, pyranine) to monitor proton translocation across the liposomal membrane.

  • Membrane Potential Assays: Potentiometric dyes like DiSC3(5) can measure changes in membrane potential associated with proton movement.

  • Coupled ATP Synthesis/Hydrolysis: When reconstituted with other ATP synthase subunits, measure ATP synthesis driven by artificially imposed proton gradients or ATP hydrolysis-driven proton pumping.

  • Data Analysis: The following table shows typical parameters extracted from proton translocation experiments:

ParameterMeasurement MethodExpected Range for Active ProteinUnits
Initial RateFluorescence quenching slope10-100%/min
Max. Proton GradientSteady-state fluorescence change50-90% quenching
Specificity ControlGradient collapse with ionophores>80% recovery
ATP DependenceRate vs. [ATP]K₍ₘ₎ = 0.1-1.0mM
Inhibitor SensitivityIC₅₀ for known ATP synthase inhibitorsVariableμM

What are the key interactions between ATP synthase subunit a (atpB) and other components of the ATP synthase complex in Rhizobium etli?

The atpB subunit forms critical interactions with several other components of the ATP synthase complex:

  • Interaction with c-ring: The a-subunit (atpB) forms a half-channel structure that interacts with the rotating c-ring (c-subunits) to facilitate proton translocation across the membrane. These interactions involve specific arginine residues in atpB that are crucial for proton transfer .

  • Interface with Stator Components: The a-subunit connects to the peripheral stator stalk (primarily the b-subunits), providing structural stability to counteract the torque generated during rotation.

  • Transmembrane Orientation: The atpB subunit contains multiple transmembrane helices that properly position functional residues for proton translocation.

  • F₁-F₀ Coupling: While not directly interfacing with the F₁ sector, proper function of atpB is essential for coupling proton movement to the rotational mechanics that drive ATP synthesis in the catalytic F₁ portion.

How conserved is the ATP synthase subunit a (atpB) across Rhizobium species and related bacteria?

Comparative genomic analysis reveals significant conservation patterns for atpB across rhizobial species:

  • Core Functional Domains: Transmembrane domains and proton channel-forming regions show high conservation (>80% sequence identity) among Rhizobium species.

  • Phylogenetic Distribution: The following table summarizes conservation across related bacterial groups:

Bacterial GroupSequence Identity to R. etli atpBConserved Functional MotifsNotable Variations
Rhizobium species85-95%Proton channel, membrane anchorsTerminal regions
Sinorhizobium/Ensifer75-85%Proton channel, membrane anchorsSeveral TM helices
Bradyrhizobium65-75%Proton channelAdditional residues in loops
α-Proteobacteria60-70%Critical arginine residuesLength variations
γ-Proteobacteria (E. coli)45-55%Basic channel architectureSignificant TM differences
  • Selective Pressure: Analysis indicates stronger purifying selection on residues directly involved in proton translocation compared to peripheral regions.

  • Co-evolution Patterns: atpB evolution correlates with changes in other ATP synthase subunits, particularly the c-subunit, maintaining functional compatibility within the complex.

How can recombinant Rhizobium etli ATP synthase subunit a (atpB) be used to study the mechanisms of gene conversion and homologous recombination?

Recombinant R. etli atpB can serve as a valuable tool for investigating recombination mechanisms:

  • Homologous Recombination Studies: The atpB gene can be used as a target for studying the effects of mutations in recombination systems. Research has shown that mutations in ruvB, recG, and radA affect gene conversion patterns in R. etli .

  • Experimental Design: A cointegration strategy can be employed to assess gene conversion efficiency, with the following approach:

    • Introduce markers at specific positions within the atpB gene

    • Monitor conversion tract length and position after recombination events

    • Compare patterns between wild-type and recombination-deficient strains

  • Findings from R. etli Research: Studies have revealed that:

    • The RuvAB system is highly efficient for gene conversion

    • RecG exhibits a dual role, potentially hindering heteroduplex extension in some contexts

    • RadA is less efficient but still contributes to gene conversion tract formation

  • Applications to Other Systems: Methodologies developed using R. etli atpB can be applied to study recombination in other organisms, providing insights into the universal mechanisms of genetic exchange.

What mutagenesis approaches are most effective for studying structure-function relationships in Rhizobium etli ATP synthase subunit a (atpB)?

Several mutagenesis strategies are particularly effective for investigating structure-function relationships:

  • Site-Directed Mutagenesis: Target conserved residues within the proton channel and membrane interfaces using overlap extension PCR or commercial kits.

  • Alanine-Scanning Mutagenesis: Systematically replace residues with alanine to identify functionally critical positions without drastically altering protein structure.

  • Domain Swapping: Create chimeric proteins by exchanging segments between R. etli atpB and homologs from other species to identify regions responsible for species-specific functions.

  • Experimental Assessment: The following table outlines methods for evaluating the impact of mutations:

Mutation TypeAssessment MethodExpected Outcome for Functional ResiduesControl
Conservative (similar aa)ATP synthesis rateMinimal impactWild-type protein
Non-conservativeATP synthesis rateSignificant reductionWild-type protein
Charge-alteringProton translocationAltered pH dependenceWild-type protein
Deletion/InsertionAssembly assayDisrupted complex formationWild-type protein
  • Computational Assistance: Molecular dynamics simulations can predict the impact of mutations before experimental verification, optimizing the selection of target residues.

What are common challenges in obtaining functionally active recombinant Rhizobium etli ATP synthase subunit a (atpB) and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant atpB:

  • Protein Aggregation: As a membrane protein, atpB tends to aggregate during expression and purification.

    • Solution: Optimize detergent type and concentration; consider using amphipols or nanodiscs for stabilization; add stabilizing agents like glycerol (5-10%) and trehalose (6%) .

  • Low Expression Yield: Membrane proteins often express poorly in heterologous systems.

    • Solution: Use specialized E. coli strains (C41, C43); lower induction temperature to 18°C; optimize codon usage; consider fusion partners that enhance membrane protein expression.

  • Loss of Activity During Purification:

    • Solution: Minimize exposure to harsh conditions; maintain appropriate detergent concentrations throughout purification; include phospholipids in purification buffers.

  • Reconstitution Challenges:

    • Solution: Optimize lipid composition for liposome reconstitution; adjust protein-to-lipid ratios; ensure proper orientation in liposomes using established protocols.

  • Troubleshooting Guide:

IssuePotential CausesDiagnostic ApproachResolution Strategies
No detectable proteinToxic expressionWestern blot analysisReduce expression level, use C41/C43 strains
Inclusion body formationMisfoldingFractionation analysisLower temperature, adjust inducer concentration
Loss of activityDetergent-induced denaturationActivity assays with controlsScreen alternative detergents, add lipids
Poor reconstitutionIncorrect protein:lipid ratioFluorescence assaysSystematic optimization of reconstitution parameters
DegradationProtease activitySDS-PAGE time courseAdd protease inhibitors, reduce purification time

How can I design experiments to investigate the role of Rhizobium etli ATP synthase subunit a (atpB) in symbiotic nitrogen fixation?

Investigating atpB's role in symbiotic nitrogen fixation requires a multi-faceted experimental approach:

  • Genetic Manipulation Strategies:

    • Create conditional mutants with tunable atpB expression

    • Generate point mutations in key functional residues

    • Develop complementation systems with wild-type or mutant variants

  • Phenotypic Characterization:

    • Assess nodulation efficiency on legume hosts

    • Measure nitrogenase activity via acetylene reduction assays

    • Determine bacteroid viability and development using microscopy

    • Monitor ATP/ADP ratios in nodules using metabolomic approaches

  • Experimental Design:

Experimental PhaseMethodsControlsExpected Outcomes
Gene ManipulationSite-directed mutagenesis, CRISPR-Cas9Wild-type strainVerified mutant strains
In vitro CharacterizationATP synthesis assays, proton translocationPurified wild-type proteinQuantified biochemical effects
Plant InoculationSterile seedling infectionPlants with wild-type bacteriaColonization assessment
Nodule AnalysisMicroscopy, biochemical assaysEffective wild-type nodulesStructural and functional comparisons
Metabolic AssessmentLC-MS, ATP luminescence assaysWild-type bacteroidsEnergy status measurement
  • Data Integration:

    • Correlate biochemical defects observed in vitro with symbiotic phenotypes

    • Utilize statistical methods to establish significance of observations

    • Compare results with known ATP synthase mutants in related systems

What emerging technologies can advance our understanding of Rhizobium etli ATP synthase subunit a (atpB) function and regulation?

Several cutting-edge technologies offer promising avenues for deeper insights into atpB function:

  • Cryo-Electron Microscopy: High-resolution structural determination of the complete R. etli ATP synthase complex, potentially revealing species-specific features of the proton channel and subunit interfaces.

  • Single-Molecule Biophysics: Techniques such as FRET and optical tweezers can measure conformational changes and rotational dynamics in real-time, providing insights into the mechanics of proton translocation through atpB.

  • In-cell NMR Spectroscopy: Characterize protein dynamics and interactions within the native cellular environment, capturing regulatory mechanisms not observable in purified systems.

  • Systems Biology Approaches:

    • Transcriptomic profiling under various symbiotic conditions

    • Metabolic flux analysis to quantify energy production during nodulation

    • Network modeling to integrate ATP synthase function with broader metabolic pathways

  • CRISPR-Cas9 Genome Editing: Precise manipulation of the atpB gene to create tailored variants for functional studies, including introduction of reporter tags for in vivo visualization.

How might structural modifications to Rhizobium etli ATP synthase subunit a (atpB) impact bioenergetic efficiency in nitrogen-fixing symbiosis?

Engineering atpB structure presents intriguing possibilities for enhancing symbiotic performance:

  • Rational Design Targets:

    • Optimize proton-binding residues to enhance translocation efficiency

    • Modify interfaces with other subunits to improve complex stability

    • Engineer pH-responsive elements to adapt to the acidic symbiosome environment

  • Predicted Impacts on Bioenergetics:

Modification TargetRationaleExpected Bioenergetic EffectSymbiotic Outcome
Proton channel residuesOptimize H+ coordinationIncreased ATP synthesis efficiencyEnhanced bacteroid energy state
Stator interaction sitesImprove complex stabilityReduced energy dissipationMore robust performance under stress
Regulatory domainsTune activity to symbiotic demandsBetter matched energy productionImproved carbon utilization efficiency
Interface with c-ringOptimize rotational couplingHigher mechanical efficiencyLower energy cost for ATP synthesis
  • Experimental Validation:

    • Measure ATP synthesis rates in engineered strains

    • Assess nodule formation efficiency and nitrogen fixation capacity

    • Determine competitive fitness against wild-type strains in mixed inoculation experiments

  • Theoretical Framework:

    • Molecular dynamics simulations can predict the impact of specific modifications

    • Bioenergetic modeling to estimate ATP yield per carbon substrate consumed

    • Evolutionary analysis to identify naturally selected optimizations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.