Recombinant Rhizobium etli Beta- (1-->2)glucan export ATP-binding/permease protein NdvA (ndvA)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Rhizobium etli Beta-(1→2)glucan export ATP-binding/permease protein NdvA (ndvA) is a full-length, His-tagged protein expressed in E. coli. It consists of 588 amino acids (UniProt ID: Q2K342) and is involved in the export of cyclic β-(1→2)glucan, a critical polysaccharide for rhizobial symbiosis with legume roots . Key structural features include:

  • ATP-binding domain (NBD): Facilitates energy-dependent transport.

  • Transmembrane domains (TMD): Form a pore for glucan export across the inner membrane .

PropertySpecification
SpeciesRhizobium etli
SourceE. coli expression system
TagN-terminal His tag
Protein LengthFull-length (1–588 amino acids)
Purity>90% (SDS-PAGE)
StorageLyophilized powder at -20°C/-80°C
ReconstitutionTris/PBS buffer with 6% trehalose (pH 8.0)

The amino acid sequence begins with MTLFQVYTRALRYLTVHKWRVAVVVIANVILAAITIAEP... and includes conserved motifs for ATP hydrolysis and membrane permease activity .

Symbiosis Studies

Recombinant NdvA is used to investigate:

  • Glucan transport mechanisms in rhizobial-legume interactions .

  • The role of ATP-binding cassette (ABC) transporters in bacterial secretion systems .

Expression and Purification

ParameterDetails
Expression HostE. coli
Purification MethodImmobilized metal affinity chromatography (IMAC) via His tag
StabilitySensitive to repeated freeze-thaw cycles; store aliquots at -80°C
Reconstitution AdviceAdd 5–50% glycerol for long-term storage; optimal solubility at 0.1–1.0 mg/mL

Research Findings

  • Functional Redundancy: In R. etli, homologous recombination repairs DNA double-strand breaks in plasmids carrying symbiotic genes like nifH, highlighting genomic plasticity critical for symbiosis . While ndvA itself is not directly studied here, its role in maintaining plasmid stability (via glucan export) may indirectly support symbiotic efficiency .

  • Metabolic Modeling: Genome-scale models of R. etli nitrogen fixation highlight ABC transporters like NdvA as potential targets for optimizing bacteroid-plant metabolite exchange .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have a specific format preference, please indicate your requirement in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, kindly inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for a maximum of one week.
Reconstitution
For proper reconstitution, it is advised to briefly centrifuge the vial before opening to settle the contents. Recombinant Rhizobium etli Beta- (1-->2)glucan export ATP-binding/permease protein NdvA (ndvA) should be reconstituted in deionized sterile water at a concentration of 0.1-1.0 mg/mL. To ensure long-term stability, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard protocol includes 50% glycerol, which can serve as a reference point.
Shelf Life
The shelf life of the product is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Typically, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
ndvA; RHE_CH04000; Beta-(1-->2glucan export ATP-binding/permease protein NdvA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-587
Protein Length
full length protein
Species
Rhizobium etli (strain CFN 42 / ATCC 51251)
Target Names
ndvA
Target Protein Sequence
MSLFKVYARALRYLGAYKLRVSLVVIANIVLATITIAEPILFGRIIDAISGKGEVKPILF MWAAFAVFNTVAFVLVSREADRLAHGRRATLLTEAFGRIISMPLAWHHQRGTSNALHTLL RACETLFGLWLEFMRNHLSTVIALALLVPTAMSMDLRLSAVLIVLGIAYWLIGRVVMSRT KDGQASVENHYHTVFSHVSDSISNVSVLHSYNRIEAETKALKSFANRLLEAQYPVLDWWA LASALNRMASTIAMMVVLIIGTMLVQSGELRIGDVIAFIGFANLLIARLDLMRQFATQIF EARSKLEDFYTLEDSVRDREEPAGNGEIKNVKGAIEFRDVSFGFGNSSQGLHNVSFSVKA GQTVAIVGPTGAGKTTLVNLLQRVYDPQGGQILVDGTDITKVTRKSLRRHIATVFQDAGL LNRSISDNIRLGREGASEEDMRRAAEAAAAADFIETREDRYDTHVGERGNKLSGGERQRI AIARAILKDAPILVLDEATSALDVETEARVKAAIDNLRQNRTTFIIAHRLSTVREADMVL FLDDGRVVEQGGFDELSHSNGRFAALLRASGILTDEEVRKAHTTEAA
Uniprot No.

Target Background

Function
Recombinant Rhizobium etli Beta- (1-->2)glucan export ATP-binding/permease protein NdvA (ndvA) plays a crucial role in the export of beta-(1-->2)glucan. The transmembrane domains (TMD) form a pore within the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Beta-(1-->2)glucan exporter (TC 3.A.1.108.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NdvA and what is its primary function in Rhizobium etli?

NdvA in Rhizobium etli is an ATP-binding/permease protein involved in the export of cyclic β-(1→2)glucan. Based on homology studies with related rhizobial species, NdvA belongs to a family of bacterial ATP-binding transport proteins. The protein appears to function primarily in the export of β-(1→2)glucan from the bacterial cell, which is fundamentally important for normal nodule development during symbiosis with legumes .

The most detailed characterization comes from studies of the homologous protein in Rhizobium meliloti, where NdvA has been shown to have striking homology to proteins involved in export mechanisms, particularly with Escherichia coli HlyB (involved in hemolysin export) and the mdr gene product of mammalian cells . The molecular weight of NdvA is approximately 67,100 daltons, and it consists of a single large polypeptide of about 616 amino acid residues .

How does the β-(1→2)glucan export system work in Rhizobium etli?

The β-(1→2)glucan export system in Rhizobium involves a complex biosynthetic pathway. Initially, a 235,000-dalton membrane-associated protein intermediate is involved in the synthesis of β-(1→2)glucan molecules . This protein can be labeled with UDP-[U-14C]glucose in vitro, indicating its role in glucan synthesis .

After synthesis, the NdvA protein facilitates the export of these β-(1→2)glucan molecules from the cell. The process appears to be ATP-dependent, consistent with NdvA's homology to other ATP-binding transport proteins. When the ndvA gene is mutated, as demonstrated in R. meliloti, the cells fail to export β-(1→2)glucan to the extracellular environment even though the synthesizing protein intermediate remains active . This suggests that NdvA's primary role is in the export rather than the synthesis of β-(1→2)glucan.

Table 1: Comparison of β-(1→2)glucan production in wild-type and ndvA mutant strains

Cellular FractionWild-type (F34)ndvA Mutant (LI1)
Periplasmic β-(1→2)glucanPresentAbsent
Cell supernatant β-(1→2)glucanPresentAbsent
235,000-Da protein intermediatePresentPresent (increased)
UDP-[14C]glucose labeling of proteinPositivePositive (enhanced)

Why is NdvA important for symbiotic nitrogen fixation?

NdvA plays a critical role in the symbiotic relationship between Rhizobium etli and leguminous plants through its involvement in β-(1→2)glucan export. In studies with related Rhizobium species, ndvA mutants exhibited severe symbiotic defects, forming small, white, empty nodules that were unable to fix nitrogen effectively . This indicates that the proper export of β-(1→2)glucan is essential for establishing functional nitrogen-fixing nodules.

The significance of this export system is further highlighted when considering that R. etli is an α-proteobacterium capable of fixing atmospheric nitrogen in symbiotic association with bean plants . The symbiotic plasmid in R. etli CFN42 (p42d, 371.2 kb) contains most genes required for nodulation and nitrogen fixation . Proper functioning of NdvA ensures the export of β-(1→2)glucan, which appears to be necessary for normal development of this symbiotic relationship.

What methods can be used to generate and characterize ndvA mutants?

To generate ndvA mutants in Rhizobium etli, several approaches can be employed:

  • Transposon Mutagenesis: Inserting transposons (such as Tn5) into the ndvA gene can create loss-of-function mutations. For example, the LI1 strain described in the literature carries a Tn5lac insertion in the ndvA gene .

  • Targeted Gene Replacement: Using homologous recombination to replace the wild-type ndvA gene with a mutated version. In R. etli, homologous recombination has been shown to work efficiently . This approach can be facilitated by using suicide vectors that cannot replicate in Rhizobium.

  • I-SceI-Mediated Gene Modification: As demonstrated in R. etli for other genes, the I-SceI endonuclease system can be used to create specific double-strand breaks that, when repaired, can introduce mutations or deletions in the target gene .

For characterization of ndvA mutants, key methods include:

  • Phenotypic Assessment: Evaluating symbiotic properties by inoculating bean plants and observing nodule formation, nitrogen fixation capacity, and plant growth.

  • β-(1→2)Glucan Analysis: Extracting and analyzing cellular and extracellular fractions for the presence of β-(1→2)glucan using methods like chromatography on Biogel P4 columns .

  • Protein-Sugar Intermediate Detection: Analyzing the 235,000-Da protein intermediate involved in β-(1→2)glucan synthesis through techniques like SDS-PAGE and UDP-[14C]glucose labeling .

How can I analyze β-(1→2)glucan production and export in R. etli?

To analyze β-(1→2)glucan production and export in Rhizobium etli, several complementary approaches can be used:

  • Separation of Cellular Fractions:

    • Periplasmic fraction: Extract using osmotic shock procedures

    • Cell supernatant: Collect culture supernatant after centrifugation

    • Total cellular fraction: Lyse cells completely

  • Purification and Quantification:

    • Ion-exchange chromatography: Use anion-exchange resin (e.g., AG1-X4) to isolate neutral carbohydrate fractions

    • Gel filtration: Employ Biogel P4 column chromatography to separate β-(1→2)glucan based on molecular size

    • Carbohydrate assays: Quantify using methods such as anthrone-sulfuric acid or phenol-sulfuric acid assays

  • Detection of Biosynthetic Intermediates:

    • Analyze membrane proteins by SDS-PAGE to detect the 235,000-Da protein intermediate

    • Label with UDP-[14C]glucose to identify proteins involved in β-(1→2)glucan synthesis

    • Perform in vitro glucan synthase assays with membrane fractions

The results can be quantified using Kav values in gel filtration chromatography, where Kav = (Ve - V0)/(Vt - V0), with Ve representing elution volume, V0 the void volume, and Vt the total volume .

What approaches can be used to study the structure-function relationship of NdvA?

Studying the structure-function relationship of NdvA involves several sophisticated approaches:

  • Sequence Analysis and Homology Modeling:

    • Perform sequence alignments with homologous proteins like E. coli HlyB and mammalian mdr gene products

    • Identify conserved ATP-binding domains and transmembrane segments

    • Generate structural models based on related proteins with known structures

  • Site-Directed Mutagenesis:

    • Target conserved residues in ATP-binding domains or transmembrane regions

    • Create point mutations in the ndvA gene using PCR-based mutagenesis

    • Express mutated versions in ndvA-deficient backgrounds

    • Assess the impact on β-(1→2)glucan export and symbiotic phenotypes

  • Protein-Protein Interaction Studies:

    • Use co-immunoprecipitation to identify proteins that interact with NdvA

    • Employ bacterial two-hybrid systems to screen for interaction partners

    • Perform crosslinking studies to capture transient interactions

  • Functional Domain Analysis:

    • Create truncated versions of NdvA to identify essential functional domains

    • Design chimeric proteins by swapping domains with related transporters

    • Express these variants in ndvA mutants to assess complementation

How does NdvA compare to similar export proteins in other Rhizobium species?

NdvA in Rhizobium etli belongs to a family of ATP-binding transporters found across various Rhizobium species. The most well-characterized homolog is in Rhizobium meliloti, where the ndvA gene product has been shown to be essential for β-(1→2)glucan production and symbiotic association with alfalfa . The ndvA locus in R. meliloti is also homologous to and can substitute for the chvA locus of Agrobacterium tumefaciens , suggesting functional conservation across related species.

Comparative analysis reveals that NdvA has significant homology to several bacterial ATP-binding transport proteins, with the greatest similarity to E. coli HlyB (involved in hemolysin export) and the mdr gene product of mammalian cells . This suggests evolutionary conservation of fundamental export mechanisms across diverse organisms.

Table 2: Comparison of NdvA homologs across bacterial species

SpeciesProteinMolecular WeightFunctionSymbiotic Phenotype of Mutants
R. etliNdvA~67,100 Daβ-(1→2)glucan exportDefective nodulation (inferred)
R. melilotiNdvA67,100 Daβ-(1→2)glucan exportSmall, white, empty nodules
A. tumefaciensChvASimilar to NdvASimilar export functionAvirulent
E. coliHlyBHomologous to NdvAHemolysin exportN/A (non-symbiotic)

What is the relationship between NdvA function and symbiotic plasmid stability?

The relationship between NdvA function and symbiotic plasmid stability presents an intriguing research question. In R. etli CFN42, the genome includes a main chromosome, one secondary chromosome, and five large plasmids, with p42d (371.2 kb) designated as the symbiotic plasmid containing most genes required for nodulation and nitrogen fixation . This plasmid exhibits unusual stability, possibly due to the presence of multiple toxin-antitoxin modules .

Research has shown that homologous recombination between identical gene copies (such as nifH) can provoke large deletions in the symbiotic plasmid, leading to loss of symbiotic abilities . Given that NdvA is involved in β-(1→2)glucan export critical for symbiosis, mutations in ndvA might interact with mechanisms of plasmid stability in complex ways.

Experimental approaches to investigate this relationship could include:

  • Analyzing plasmid stability in ndvA mutants under various stress conditions

  • Investigating potential interactions between NdvA and toxin-antitoxin systems

  • Examining whether β-(1→2)glucan export influences homologous recombination rates within the symbiotic plasmid

How does NdvA function integrate with other symbiotic processes in R. etli?

NdvA's role in exporting β-(1→2)glucan likely intersects with multiple symbiotic processes in R. etli. Recent research has demonstrated that R. etli can emit nitrous oxide (N₂O) in response to nitrate (NO₃⁻) during symbiosis with Phaseolus vulgaris . This emission involves bacteroidal assimilatory nitrate reductase (NarB), nitrite reductase (NirK), and nitric oxide reductase (cNor) .

The integration of NdvA function with these processes remains largely unexplored but may involve:

  • Signaling Coordination: β-(1→2)glucan may serve as a signaling molecule that coordinates nitrogen metabolism with nodule development.

  • Stress Response Integration: NdvA-mediated export might respond to the same environmental cues that trigger changes in nitrogen metabolism.

  • Metabolic Interactions: ATP consumption by NdvA during export could influence the energy availability for other symbiotic processes.

Research approaches to explore these interactions could include:

  • Creating double mutants (ndvA with narB, nirK, or nor genes) to assess epistatic relationships

  • Measuring β-(1→2)glucan export under conditions that alter nitrogen metabolism

  • Conducting transcriptomic and proteomic analyses to identify co-regulated pathways

What are the key challenges in purifying and characterizing recombinant NdvA?

Purification and characterization of recombinant NdvA present several significant challenges:

  • Membrane Protein Solubilization: As a transmembrane protein, NdvA is inherently difficult to solubilize while maintaining its native conformation. Researchers must optimize detergent types, concentrations, and solubilization conditions.

  • Expression Systems: Traditional E. coli expression systems may not correctly fold or post-translationally modify rhizobial membrane proteins. Alternative expression systems to consider include:

    • Homologous expression in Rhizobium

    • Expression in other gram-negative bacteria

    • Cell-free expression systems

  • Functional Assays: Developing in vitro assays to measure NdvA's ATP-binding and β-(1→2)glucan transport activities requires reconstitution in artificial membrane systems like liposomes or nanodiscs.

  • Structural Analysis: Obtaining high-resolution structural data for membrane transporters is challenging. Approaches might include:

    • X-ray crystallography with stabilizing mutations or antibody fragments

    • Cryo-electron microscopy

    • Nuclear magnetic resonance of specific domains

A promising strategy could involve leveraging recent advances in protein design and structure prediction. Deep learning approaches like those described for protein structure modeling might help predict NdvA's structure and inform experimental design.

How can I investigate the regulation of ndvA gene expression?

Investigating the regulation of ndvA gene expression requires a multi-faceted approach:

  • Promoter Analysis:

    • Clone the promoter region upstream of reporter genes (e.g., lacZ, gfp)

    • Create promoter deletion series to identify key regulatory elements

    • Use site-directed mutagenesis to modify putative transcription factor binding sites

    • Analyze expression under various environmental conditions (pH, osmolarity, nutrients)

  • Transcriptomic Approaches:

    • Perform RNA-Seq under different growth and symbiotic conditions

    • Use quantitative RT-PCR to measure ndvA transcript levels

    • Identify co-regulated genes through cluster analysis

  • Transcription Factor Identification:

    • Conduct DNA-protein interaction studies (electrophoretic mobility shift assays)

    • Implement chromatin immunoprecipitation (ChIP) to identify proteins binding to the ndvA promoter

    • Use one-hybrid systems to screen for potential transcriptional regulators

  • Post-transcriptional Regulation:

    • Analyze mRNA stability through actinomycin D chase experiments

    • Investigate potential small RNA regulation

    • Examine translational control mechanisms

Understanding ndvA regulation could provide insights into how R. etli coordinates β-(1→2)glucan export with other symbiotic processes and environmental responses.

What new technologies might advance our understanding of NdvA function?

Several emerging technologies could significantly advance our understanding of NdvA function:

  • CRISPR-Cas9 Genome Editing:

    • Create precise mutations in ndvA without marker genes

    • Implement CRISPRi for conditional knockdowns

    • Design CRISPR-based screens to identify genetic interactions

  • Advanced Imaging Techniques:

    • Use super-resolution microscopy to visualize NdvA localization

    • Implement FRET-based biosensors to detect ATP binding and hydrolysis

    • Apply single-molecule tracking to observe NdvA dynamics in living cells

  • Metabolomics and Fluxomics:

    • Trace carbon flow into β-(1→2)glucan using stable isotope labeling

    • Profile metabolites in wild-type versus ndvA mutants

    • Measure ATP consumption associated with NdvA function

  • Computational Approaches:

    • Utilize deep learning for protein structure prediction as mentioned in recent literature

    • Apply molecular dynamics simulations to study transport mechanisms

    • Implement systems biology models to integrate NdvA function with broader cellular processes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.