Recombinant Rhizobium etli Biotin transporter BioY (bioY)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rhizobium etli Biotin Transporter BioY (bioY)

Recombinant Rhizobium etli Biotin Transporter BioY (bioY) is a heterologously expressed protein involved in the uptake of biotin, a vital cofactor for carboxylation enzymes. This transporter belongs to the BioY family, which functions in high-affinity biotin acquisition in bacteria. The recombinant form is typically produced in Escherichia coli with an N-terminal His tag for purification and functional studies . BioY operates either independently as a high-capacity transporter or synergistically with BioM and BioN (components of an ABC transporter system) to form a high-affinity uptake complex .

Genetic Organization

The bioY gene in R. etli is part of the bioMNY operon, which is transcriptionally repressed by biotin . The operon structure and protein domains are summarized below:

GeneFunctionHomologyDomain Features
bioMATP-binding component (ATPase)41% identity to Sinorhizobium meliloti BioMWalker A/B motifs, ABC transporter signature
bioNPermease component25% identity to S. meliloti BioN4 transmembrane helices, EAA-like loop
bioYBiotin transporter (transmembrane)35% identity to Corynebacterium glutamicum6–8 transmembrane helices, no EAA loop

Protein Structure

BioY is a transmembrane protein predicted to contain 6–8 α-helical membrane-spanning regions . Structural modeling suggests it lacks the EAA loop characteristic of classical ABC transporters, distinguishing it from BioN .

Transport Mechanisms

  • Standalone Activity: BioY alone functions as a high-capacity transporter with a Michaelis constant (K<sub>m</sub>) of 250 nM and maximal velocity (V<sub>max</sub>) of 60 pmol·min<sup>−1</sup>·(mg protein)<sup>−1</sup> .

  • BioMNY Complex: Co-expression with BioM and BioN converts BioY into a high-affinity system, reducing K<sub>m</sub> to 5 nM and V<sub>max</sup> to 6 pmol·min<sup>−1</sup>·(mg protein)<sup>−1</sup> .

SystemK<sub>m</sub> (nM)V<sub>max</sub> (pmol·min<sup>−1</sup>·mg<sup>−1</sup>)Affinity
BioY alone25060High capacity
BioMNY complex56High affinity

ATPase Dependency

BioM’s ATPase activity is critical for high-affinity transport. A BioM K42N mutation (disrupting the Walker A motif) reduced biotin uptake by 90% at low concentrations (100 pM–10 nM) .

Recombinant Protein Production

The recombinant BioY protein (UniProt ID: Q2KBP7) is expressed in E. coli as a full-length 187-amino-acid polypeptide with an N-terminal His tag . Key production details include:

  • Host: E. coli strain S1039 (biotin transport-deficient) .

  • Vector: Plasmid under lac promoter control .

  • Applications: Used in uptake assays, competitive nodulation studies, and structural analyses .

Biotin Uptake Deficiency in Mutants

  • R. etli bioY mutants exhibited 50–70% lower biotin uptake than wild-type strains .

  • bioM mutants accumulated 40% less intracellular biotin .

Ecological and Symbiotic Impact

  • bioM mutants showed reduced competitiveness in nodule formation on bean plants, highlighting BioY’s role in rhizobial symbiosis .

Modular Transport Flexibility

BioY’s dual functionality (high-capacity standalone vs. high-affinity complex) allows R. etli to adapt to fluctuating biotin levels in soil and host environments .

Regulatory Mechanisms

The bioMNY operon is repressed under biotin-replete conditions. mRNA levels of bioY increase 4.9-fold during biotin limitation and decrease 5.3-fold under excess .

Applications and Implications

  • Biotin Production: Overexpression of bioYMN in Corynebacterium glutamicum increased biotin uptake 50-fold, enabling industrial biotin synthesis optimization .

  • Agricultural Relevance: BioY-deficient rhizobia are less effective in legume symbiosis, impacting nitrogen fixation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it; we will prioritize its use in the manufacturing process.
Synonyms
bioY; RHE_CH00928; Biotin transporter BioY; Biotin ECF transporter S component BioY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Rhizobium etli (strain CFN 42 / ATCC 51251)
Target Names
bioY
Target Protein Sequence
MSTRDLVLTALFAAIIVALGLLPPISLGFIPVPITAQSLGVMMAGVVLGARRGAIAVLIV LLLVAIGLPVLSGGRGGLAIFASPTAGFLVGWIFGAFVTGYLSERLVNHGQSGLVQTVSF FLAAMIGGIVVLYAFGITYLATVAGLGFTKAFVGSMAFIPGDVIKAVVAALLGRAVMVGY PLLPARA
Uniprot No.

Target Background

Function

Involved in biotin uptake.

Database Links
Protein Families
BioY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of the BioY transporter in Rhizobium etli?

BioY is a critical component of the biotin transport system in Rhizobium etli. Experimental evidence confirms that BioY functions as a high-capacity biotin transporter. When expressed alone, BioY demonstrates significant biotin uptake capability, allowing cells to accumulate the vitamin approximately 1,000-fold in long-term assays, indicating an active transport mechanism rather than simple diffusion . Mutation studies have provided direct experimental evidence for BioY's role in biotin transport, as R. etli bioY mutants exhibit significantly lower biotin uptake compared to wild-type strains . This transporter is particularly important for R. etli since this organism lacks orthodox biotin biosynthesis genes and depends on external biotin sources .

How is the BioY transporter related to other components of the biotin transport system?

BioY is part of the bioMNY operon in R. etli, which encodes a tripartite biotin transport system. While BioY serves as the central transport unit, BioM and BioN play crucial complementary roles. BioM resembles the ATPase component of ABC-type transporters, while BioN functions as a permease component . Together, these three proteins form stable complexes in bacterial membranes. Biochemical assays have demonstrated that while BioMN can form stable complexes in the absence of BioY, BioMY and BioNY aggregates are detected only in low amounts when the respective third partner is missing . This suggests that the complete tripartite structure provides optimal stability and functionality for the transport system.

What experimental approaches can be used to study BioY function?

Several methodological approaches have proven effective for studying BioY function:

  • Heterologous expression systems: Expressing the R. etli bioY gene or the complete bioMNY operon in biotin transport-deficient strains (such as E. coli S1039) allows for functional analysis in a controlled genetic background .

  • Gene disruption: Creating bioY mutants through targeted gene disruption provides insights into the transporter's physiological importance. This approach revealed decreased biotin uptake in R. etli bioY mutants compared to wild-type strains .

  • Radioisotope uptake assays: Using radiolabeled biotin to measure transport rates at different substrate concentrations enables determination of kinetic parameters such as maximum velocity and affinity constants .

  • Complementation studies: Restoring biotin transport function by introducing the wild-type bioY gene into mutant strains confirms the gene's role in transport .

What is known about the genetic organization of the biotin transport system in R. etli?

In Rhizobium etli, the biotin transport genes are organized in the bioMNY operon located on the chromosome. This organization resembles that found in other prokaryotes, particularly within the α-proteobacteria. Genome context analyses across bacterial species have revealed that only about one-third of the widespread bioY genes are linked to bioMN . Many bioY genes are located at loci encoding biotin biosynthesis, while others are unlinked to biotin metabolic or transport genes, suggesting diverse evolutionary paths and regulatory mechanisms . In R. etli, the bioMNY operon is transcriptionally repressed by biotin, indicating a regulatory feedback mechanism that controls transporter expression based on biotin availability .

How do the kinetic properties of BioY differ when expressed alone versus as part of the complete BioMNY system?

The kinetic properties of BioY undergo significant changes when functioning alone versus as part of the complete BioMNY complex, revealing important insights about its mechanistic operation:

ParameterBioY AloneBioMNY ComplexFold Change
Maximum velocity (Vmax)60 pmol × min⁻¹ × (mg protein)⁻¹~6 pmol × min⁻¹ × (mg protein)⁻¹10× lower in BioMNY
Half-saturation constant (Km)~250 nM~5 nM50× lower in BioMNY
Transport capacityHigh capacityHigh affinityFunctional shift

What is the molecular mechanism by which BioM's ATPase activity contributes to high-affinity biotin transport?

The molecular mechanism underlying BioM's contribution to high-affinity biotin transport involves ATP hydrolysis-driven conformational changes. Experimental evidence shows that BioMNY-mediated biotin uptake is severely impaired when the Walker A lysine residue in BioM is replaced, demonstrating the dependency of high-affinity transport on a functional ATPase .

This mechanism appears to follow a model where:

  • BioY alone can facilitate biotin translocation across the membrane through a passive or low-energy mechanism, resulting in high-capacity but lower-affinity transport.

  • When BioM hydrolyzes ATP, the energy is coupled to conformational changes in the transporter complex that substantially increase binding affinity for biotin.

  • The BioN component likely serves as a structural intermediary that transmits conformational changes between BioM and BioY.

This mechanism represents a distinctive feature compared to classical ABC transporters, as the BioMNY system lacks extracytoplasmic solute-binding proteins typically found in other ABC transporters . This suggests that BioY itself may contain both the translocation pathway and the primary binding site for biotin, with BioM's ATPase activity serving to enhance binding affinity rather than being absolutely required for transport.

How can protein-protein interactions within the BioMNY complex be experimentally characterized?

Characterizing protein-protein interactions within the BioMNY complex requires sophisticated biochemical and biophysical approaches:

  • Co-immunoprecipitation: Using antibodies against one component to precipitate the entire complex, followed by detection of interacting partners through western blotting.

  • Bacterial two-hybrid systems: These can detect binary interactions between BioM, BioN, and BioY when expressed as fusion proteins with complementary fragments of a reporter protein.

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry analysis can identify interacting regions and amino acid residues at protein interfaces.

  • Fluorescence resonance energy transfer (FRET): By tagging BioM, BioN, and BioY with appropriate fluorophores, FRET can detect proximity and conformational changes during transport.

  • Expression of truncated operons: As demonstrated in the research, expressing operons with one gene deleted (e.g., bioMN, bioMY, bioNY) provides insights into which components can form stable subcomplexes . This approach revealed that BioMN forms stable complexes, while BioMY and BioNY aggregates are detected only in low amounts in the absence of the respective third partner.

  • Blue native PAGE: This technique can be used to analyze intact membrane protein complexes and determine their oligomeric state and stability under various conditions.

What experimental approaches can determine the structure-function relationship in BioY?

Understanding structure-function relationships in BioY requires integrating multiple experimental strategies:

  • Site-directed mutagenesis: Systematic modification of conserved amino acid residues can identify those critical for biotin binding, transport, and interaction with BioM and BioN.

  • Domain swapping: Exchanging domains between BioY proteins from different species can help identify regions responsible for specific functional properties.

  • Cysteine accessibility studies: Introducing cysteine residues at various positions followed by chemical labeling can reveal which regions are exposed to the aqueous environment versus embedded in the membrane.

  • Protein crystallography or cryo-electron microscopy: These techniques can provide atomic-resolution structures of BioY alone or in complex with BioMN, revealing the structural basis for transport. Though challenging with membrane proteins, these approaches have become increasingly feasible.

  • Molecular dynamics simulations: Based on structural data, computational simulations can model conformational changes during the transport cycle and predict how biotin moves through the transporter.

  • Heterologous expression systems: Using expression systems like those demonstrated with R. capsulatus bioY in E. coli allows functional testing of modified BioY variants in a controlled genetic background .

What is the role of BioY in Rhizobium-legume symbiosis?

The biotin transport system plays a crucial role in Rhizobium-legume symbiosis, with significant implications for plant-microbe interactions. Experimental evidence indicates that disruption of biotin transport affects the symbiotic relationship between Rhizobium and leguminous plants. Analysis of competitiveness between wild-type strains and bioM mutants revealed that mutants with diminished biotin transport capacity had significantly reduced nodulation efficiency on bean plants .

This finding suggests that efficient biotin acquisition is essential for:

  • Proper bacterial metabolism during the infection process

  • Establishment and maintenance of nitrogen-fixing nodules

  • Competitive fitness in the rhizosphere environment

The symbiotic relationship between R. etli and its host plants (particularly Phaseolus vulgaris, common bean) appears to have co-evolved, as demonstrated by studies showing geographic correlations between R. etli lineages and bean genetic pools . This suggests that variations in biotin transport efficiency may have contributed to the adaptations of specific R. etli strains to different bean varieties across diverse geographic regions.

How does the expression of the bioMNY operon respond to environmental conditions?

The expression of the bioMNY operon in R. etli is regulated in response to environmental conditions, particularly biotin availability. Research has demonstrated that the bioMNY operon is transcriptionally repressed by biotin , representing a classic feedback inhibition mechanism. This regulatory system ensures that:

  • When biotin is abundant in the environment, transporter expression is downregulated to prevent unnecessary energy expenditure.

  • When biotin becomes limiting, transporter expression increases to maximize biotin acquisition.

The dual nature of the BioY transport system (high-capacity as BioY alone versus high-affinity as BioMNY) may represent an adaptation to fluctuating biotin availability in soil environments. The high-capacity system could function when biotin is moderately available, while the energy-intensive high-affinity system would be engaged under severe biotin limitation .

Additional research is needed to determine whether other environmental factors such as pH, oxygen levels, carbon source availability, or plant-derived signals also influence bioMNY expression during different stages of the Rhizobium life cycle and symbiotic interaction.

What approaches can be used to study the in vivo dynamics of BioY transport in Rhizobium etli?

Studying the in vivo dynamics of BioY transport in R. etli requires techniques that can monitor transporter activity in living bacteria under various conditions:

  • Fluorescent biotin analogs: Using fluorescent derivatives of biotin to visualize uptake and intracellular distribution in real-time through fluorescence microscopy.

  • Reporter gene fusions: Constructing transcriptional or translational fusions of bioY with reporter genes (e.g., GFP, luciferase) to monitor expression levels under different environmental conditions.

  • Metabolomic approaches: Measuring intracellular biotin and biotin-dependent metabolite levels using liquid chromatography-mass spectrometry (LC-MS) to assess the physiological impact of BioY activity.

  • Single-cell analysis: Flow cytometry or microfluidic approaches to examine variability in BioY expression and activity within bacterial populations.

  • In planta imaging: Developing techniques to visualize biotin transport in bacteria during root colonization and nodule formation to understand the role of BioY during symbiosis.

  • Isotope labeling: Using stable isotope-labeled biotin (e.g., ¹³C-biotin) combined with mass spectrometry to track biotin flux and turnover rates in living cells.

How does the BioY transporter of Rhizobium etli compare to biotin transporters in other bacterial species?

The BioY transporter of R. etli represents one example of a widespread family of biotin transporters found across diverse bacterial species. Comparative analysis reveals both conserved features and notable differences:

FeatureR. etli BioYBioY in Other SpeciesSignificance
Operon structurebioMNYVariable - bioMNY in some species, solitary bioY in othersEvolutionary divergence
Function without BioMNHigh-capacity transportSimilar high-capacity function observed in R. capsulatusConserved core function
Genomic contextChromosomalOften linked to biotin biosynthesis genes in some speciesVarying regulatory integration
Phylogenetic distributionα-proteobacteriaWidespread across bacterial phylaAncient evolutionary origin

Genome context analyses have revealed that only about one-third of the widespread bioY genes across bacterial species are linked to bioMN, while many are located at loci encoding biotin biosynthesis enzymes, and others are unlinked to any biotin-related genes . This suggests multiple evolutionary trajectories for biotin transport systems.

The BioY transporter represents a member of a mechanistically novel group of membrane transporters that lack extracytoplasmic solute-binding proteins typically found in classical ABC transporters, suggesting a distinct evolutionary lineage with unique structural and functional properties .

What is the evolutionary relationship between the BioMNY system and other ABC transporters?

The BioMNY system represents an intriguing evolutionary case among transporters. While sharing some features with classical ABC transporters, it also displays distinctive characteristics:

  • Shared features: BioM contains typical ATP-binding cassette motifs including the Walker A and B sequences common to ABC-type ATPases, and its function is essential for high-affinity transport .

  • Distinctive features: Unlike classical ABC transporters, the BioMNY system lacks extracytoplasmic solute-binding proteins that typically capture substrate molecules and deliver them to the translocation pathway .

  • Evolutionary implications: The BioMNY system may represent either:

    • An ancestral form of ABC transporters that predates the incorporation of solute-binding proteins

    • A derived form that lost solute-binding proteins during specialization for biotin transport

    • A convergently evolved system that independently acquired ABC-like components

The fact that BioY can function independently as a transporter, with BioMN serving to enhance its affinity rather than being absolutely required for transport, suggests a modular evolution. This modular nature is further supported by the observation that bioY genes are often found without associated bioMN genes in many bacterial genomes , indicating that the high-affinity system may have evolved through the merger of previously independent transport modules.

What are the best expression systems for studying recombinant R. etli BioY protein?

Selecting the appropriate expression system is critical for successful functional and structural studies of recombinant R. etli BioY. Based on published research and general considerations for membrane protein expression, the following systems offer distinct advantages:

  • E. coli expression systems:

    • Biotin transport-deficient strains like E. coli S1039 provide a clean background for functional assays

    • pET-based vectors with T7 promoters allow controlled, high-level expression

    • C41(DE3) and C43(DE3) strains, derivatives of BL21(DE3), are often superior for membrane protein expression

  • Homologous expression in Rhizobium:

    • Expression in the native host maintains physiologically relevant membrane composition

    • Can be achieved using broad-host-range vectors with rhizobial promoters

    • Particularly valuable for studying interactions with other Rhizobium proteins

  • Other bacterial systems:

    • Lactococcus lactis has been successful for expressing challenging membrane proteins

    • Bacillus subtilis offers efficient secretion of recombinant proteins

For structural studies, expression should be optimized to maximize protein yield while maintaining proper folding. Fusion tags such as histidine tags facilitate purification, while stability-enhancing fusion partners like GFP can improve expression and allow monitoring of proper folding.

What purification strategies are most effective for isolating functional BioY protein?

Purifying functional BioY protein requires specialized approaches due to its membrane-embedded nature:

  • Membrane isolation and solubilization:

    • Differential centrifugation to isolate membrane fractions

    • Careful selection of detergents is critical; mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) often preserve function

    • Systematic screening of detergent type and concentration is recommended

  • Affinity chromatography:

    • Histidine-tagged BioY can be purified using Ni-NTA or Co-TALON resins

    • Purification buffers should include appropriate detergent concentrations to maintain solubility

    • Consider including stabilizing agents such as glycerol or specific lipids

  • Size exclusion chromatography:

    • Essential final step to remove aggregates and ensure homogeneity

    • Allows assessment of oligomeric state of the purified protein

    • Can reveal whether BioY forms stable oligomers or remains monomeric when purified

  • Functional verification:

    • Purified protein can be reconstituted into liposomes to verify transport activity

    • Binding assays using radiolabeled or fluorescent biotin can confirm substrate interaction

    • Circular dichroism spectroscopy can verify proper secondary structure content

When purifying the entire BioMNY complex, the approach must be modified to preserve protein-protein interactions, potentially using milder solubilization conditions and tandem affinity purification strategies.

What key questions remain unanswered about BioY transport mechanisms?

Despite significant advances in understanding BioY function, several critical questions remain unresolved:

  • Structural basis of transport: What is the three-dimensional structure of BioY, and how does its conformation change during the transport cycle? How does biotin binding trigger these conformational changes?

  • Energy coupling mechanism: How exactly does ATP hydrolysis by BioM influence BioY's transport properties? What structural changes propagate from BioM to BioY via BioN?

  • Substrate specificity determinants: Which amino acid residues in BioY form the biotin binding site, and how do they confer specificity for biotin over related molecules?

  • Regulatory mechanisms: How is BioY activity post-translationally regulated in response to changing cellular needs for biotin?

  • Stoichiometry question: What is the ratio of biotin molecules transported per ATP hydrolyzed in the complete BioMNY system?

  • Integration with metabolism: How is BioY-mediated biotin transport coordinated with biotin-dependent metabolic processes in R. etli?

Addressing these questions will require integrating advanced structural biology techniques with functional assays and in vivo studies to build a comprehensive understanding of this important transport system.

How might understanding BioY transport systems contribute to agricultural applications?

Research on BioY transport systems has potential applications in agricultural biotechnology, particularly for improving symbiotic nitrogen fixation:

  • Enhancing symbiotic efficiency: Engineering R. etli strains with optimized biotin transport capabilities could improve their symbiotic performance and nitrogen fixation efficiency, potentially reducing the need for chemical fertilizers.

  • Expanding host range: Understanding how biotin transport contributes to host specificity could guide efforts to expand the host range of rhizobial inoculants to non-traditional legume crops.

  • Developing improved biofertilizers: Knowledge of how biotin transport affects competitive fitness in soil environments could inform the design of more effective rhizobial biofertilizers with enhanced persistence and nodulation efficiency.

  • Biofortification strategies: Engineering plants to secrete optimal levels of biotin in root exudates could enhance colonization by beneficial rhizobia containing BioY transporters.

  • Bioremediation applications: The high-affinity nature of the BioMNY system could potentially be harnessed for engineering bacteria capable of efficient uptake of biotin-conjugated compounds for environmental cleanup.

These applications would build upon fundamental understanding of the BioY transport mechanism and its role in Rhizobium-legume symbiosis, translating basic research into practical agricultural benefits.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.