Recombinant Rhizobium etli Energy-coupling factor transporter transmembrane protein BioN (bioN)

Shipped with Ice Packs
In Stock

Description

Introduction to BioN

BioN is a transmembrane protein component of the tripartite BioMNY transporter system, an energy-coupling factor (ECF) transporter responsible for biotin uptake in Rhizobium etli. ECF transporters are modular systems composed of:

  • S unit: Substrate-specific transmembrane protein (e.g., BioY in Rhizobium etli) .

  • T unit: Conserved transmembrane protein (BioN) with cytoplasmic motifs critical for ATPase interaction .

  • A unit: ATPase (BioM) powering substrate transport .

BioN interacts with BioM (via cytoplasmic motifs) and BioY (via transmembrane domains) to form a functional complex .

Functional Role in Biotin Transport

BioN is essential for:

  • Stabilizing the BioMNY complex: Double Arg-to-Ala substitutions in BioN’s cytoplasmic motifs abolish complex formation .

  • Enabling high-affinity biotin uptake: BioMNY exhibits a 50-fold lower apparent KmK_m (5 nM) compared to BioY alone (250 nM) .

Kinetic Analysis

ParameterBioY (Single Unit)BioMNY (Tripartite)Source
KmK_m (apparent)250 nM5 nM
VmaxV_{max}60 pmol/min/mg6 pmol/min/mg
  • BioY alone: High-capacity, low-affinity transport .

  • BioMNY: Low-capacity, high-affinity transport dependent on BioM’s ATPase activity .

Mutant Studies

  • BioM K42N (Walker A motif): Severely impaired transport at all biotin concentrations .

  • BioN double Arg substitutions: Destabilizes complex formation and abolishes function .

Heterologous Expression

BioN is co-expressed with BioM and BioY in E. coli for functional studies:

  • System: E. coli strain S1039 (biotin-transport deficient) .

  • Key observations:

    • BioMNY forms stable complexes in membranes .

    • Truncated complexes (e.g., BioMN or BioNY) show reduced stability .

Research Implications

  • Mechanistic insights: BioN’s cytoplasmic motifs are critical for coupling ATP hydrolysis (via BioM) to substrate translocation .

  • Therapeutic potential: Targeting ECF transporters (e.g., biotin uptake in pathogens) for antimicrobial strategies .

Key References

  1. BioN’s role in ECF transporter stability:

  2. Kinetic differences between BioY and BioMNY:

  3. Recombinant production systems:

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
bioN; RHE_CH00929; Energy-coupling factor transporter transmembrane protein BioN
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Rhizobium etli (strain CFN 42 / ATCC 51251)
Target Names
bioN
Target Protein Sequence
MQSLYVEGNSRMHRLSPRAKLLSLTAFAILLFISHNLLLLSGAVLVAAVLYGTVGLPIGE ALLRLRPIFLTIAVVALFNLIFNPWQAALVPVLRLTALMLLAASVTATTTITEFIDEVTA LARPLERTGRVQADDIGLALGLVLRFVPEIVNRYQAIREAHKARGLKVRPTSLLAPLIIL TLKDADNVAAAIDARRIRRHGS
Uniprot No.

Target Background

Function

Involved in biotin uptake.

Database Links
Protein Families
CbiQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rhizobium etli Energy-coupling factor transporter transmembrane protein BioN?

BioN is a transmembrane component of the Energy-coupling factor (ECF) transporter system found in Rhizobium etli (strain CFN 42 / ATCC 51251), classified under UniProt accession number Q2KBP6 . The protein functions as part of a tripartite complex involved in biotin transport across bacterial membranes. ECF transporters represent a distinct class of ATP-binding cassette (ABC) transporters that facilitate the uptake of various micronutrients in prokaryotes. The BioN protein specifically serves as the transmembrane component in the biotin transport system, working in conjunction with other proteins to facilitate vitamin uptake at varying environmental concentrations. As a structural component of the bacterial membrane, BioN plays a critical role in maintaining the integrity of the transport complex.

What is the amino acid sequence and structural features of BioN protein?

The BioN protein from Rhizobium etli consists of 202 amino acids with the following sequence: MQSLYVEGNSRMHRLSPRAKLLSLTAFAILLFISHNLLLLSGAVLVAAVLYGTVGLPIGEALLRLRPIFLTIAVVALFNLIFNPWQAALVPVLRLTALMLLASVTATTTITEFIDETVALARPLERTGRVQADDIGLALGLVLRFVPEIVNRYQAIREAHKARGLKVRPTSLLAPLIILTLKDADNVAAAIDARRIRRHGS . The protein contains hydrophobic regions typical of transmembrane proteins, facilitating its integration into the bacterial cell membrane. BioN's structure is characterized by multiple transmembrane domains that anchor the protein within the lipid bilayer, positioning it to facilitate the movement of biotin molecules across the membrane barrier. These structural features enable BioN to form a functional interface with other components of the ECF transporter system, particularly BioM and BioY.

How does BioN contribute to the biotin transport system in prokaryotes?

BioN functions as an integral part of the bioMNY operon, which encodes a complete biotin transport system in prokaryotes . Within this system, BioN serves as a transmembrane component that works in conjunction with BioM (the ATP-binding cassette protein) and BioY (the substrate-specific component). While BioY is considered the central unit of the biotin transporter and can function independently to some degree, the presence of both BioM and BioN significantly enhances transport efficiency, particularly under low-biotin conditions that resemble natural environments. Experimental evidence demonstrates that the complete BioMNY complex exhibits markedly higher affinity for biotin compared to BioY alone, with the half-saturation constant for biotin being approximately 50-fold lower for the complete complex . This indicates that BioN plays a crucial role in optimizing the transport system's performance, especially when biotin availability is limited.

What are the kinetic differences between BioY alone and the complete BioMNY system in biotin transport?

The kinetic profiles of biotin transport mediated by BioY alone versus the complete BioMNY system reveal significant functional differences. When expressed in E. coli, cells containing only BioY demonstrated biotin uptake with a maximal velocity (Vmax) of approximately 60 pmol × min^-1 × (mg protein)^-1 and were half-saturated at a biotin concentration of approximately 250 nM . In contrast, cells expressing the complete BioMNY system exhibited a Vmax value that was lower by an order of magnitude, but with a dramatically enhanced substrate affinity, as evidenced by a 50-fold lower apparent half-saturation constant .

How does mutation of key amino acids in BioM affect the function of the BioMNY complex?

Site-directed mutagenesis studies provide critical insights into the structure-function relationship within the BioMNY complex. Specifically, the K42N substitution within the Walker A motif of BioM has been extensively studied to understand the role of ATPase activity in biotin transport. The Walker A motif is a conserved sequence essential for ATP binding and hydrolysis in ABC transporters. When the lysine at position 42 in BioM was replaced with asparagine (K42N), the resulting BioM K42NNY mutant holotransporter exhibited significantly diminished biotin transport activity across all substrate concentrations tested (100 pM to 200 nM) .

This experimental approach demonstrates that a functional BioM ATPase is required for efficient biotin transport, particularly under low-substrate conditions. The dramatic reduction in transport activity resulting from this single amino acid substitution (similar to the 99% inhibition observed in the E. coli maltose transporter with an analogous mutation) confirms that ATP hydrolysis by BioM provides the energy necessary for high-affinity biotin uptake . This methodological approach of targeted mutation offers a powerful tool for dissecting the functional contributions of specific domains and residues within the BioMNY transport system.

What methodologies are most effective for expressing and studying the BioN protein in laboratory settings?

Effective study of the BioN protein requires specific methodological approaches for expression, purification, and functional analysis. Based on established protocols, heterologous expression in E. coli has proven successful for investigating BioN and its associated transport complex. The following methodological framework has been validated:

For expression studies, the bioMNY operon (including bioN) can be amplified by PCR using specific primers that introduce appropriate restriction sites (e.g., NcoI at the 5' end of bioM and BglII downstream of bioY) . The purified amplicon is then inserted into an expression plasmid under control of an inducible promoter, such as the lac promoter. For optimal expression, it may be necessary to modify the native start codon (e.g., replacing TTG with ATG) . The recombinant plasmid is then transformed into an appropriate E. coli strain, such as a biotin transport-deficient strain (e.g., E. coli S1039) for functional studies or an OmpT-deficient strain (e.g., E. coli UT5600) for protein purification .

For functional analysis, biotin-uptake assays provide valuable information about transport activity. Cells expressing BioN (as part of the BioMNY complex or subcomplexes) are grown in appropriate medium, typically supplemented with necessary cofactors and an inducer for the expression system. After harvesting and washing, cells are resuspended in uptake buffer and incubated with radiolabeled biotin (e.g., d-[8,9-³H]biotin). Transport activity can be measured through either long-term accumulation assays or kinetic analysis by sampling at multiple time points .

What experimental approaches can be used to measure biotin uptake in cells expressing BioN?

Quantitative analysis of biotin uptake in cells expressing BioN requires specialized experimental techniques that allow for precise measurement of transport activity. The following methodological approach has been validated in research settings:

Recombinant cells (typically E. coli strains expressing BioN as part of various BioMNY configurations) are grown overnight at 37°C in supplemented mineral salts medium containing appropriate buffers, carbon sources, and nutrients. Components typically include phosphate buffer (pH 7.0), glucose, NH₄Cl, MgSO₄, CaCl₂, FeCl₃, amino acids, vitamins (including a controlled amount of biotin), antibiotics for plasmid selection, and an inducer for gene expression .

After growth, cells are harvested, washed, and resuspended in uptake buffer to a standardized optical density (e.g., OD₅₇₈≈0.2). For long-term accumulation studies, radiolabeled biotin (e.g., d-[8,9-³H]biotin at 4 nM) is added, and cells are incubated for several hours (e.g., 3.5 hours) at 37°C with continuous shaking. At the end of the incubation period, cell suspensions are filtered through cellulose nitrate filters, washed multiple times with uptake buffer, and filter-bound radioactivity is quantified using liquid scintillation counting .

For kinetic analysis, a similar procedure is followed, but samples are taken at multiple time points (typically within 3 minutes after addition of radiolabeled biotin) across a range of substrate concentrations (e.g., 100 pM to 1 μM). This approach allows calculation of initial transport rates in the linear range of uptake, providing critical parameters such as maximal velocity (Vmax) and half-saturation constants .

How do different biotin concentrations affect the transport activity of systems containing BioN?

The response of BioN-containing transport systems to varying biotin concentrations reveals sophisticated regulatory mechanisms that optimize nutrient acquisition under different environmental conditions. Experimental data comparing biotin uptake across different protein combinations (BioY, BioMNY, BioM K42NNY, BioMY, and BioNY) at biotin concentrations ranging from 100 pM to 200 nM demonstrate concentration-dependent performance profiles .

At very low biotin concentrations (100 pM to approximately 10 nM), the complete BioMNY complex exhibits significantly higher transport activity compared to BioY alone. This advantage diminishes as biotin concentration increases, with the relationship inverting at concentrations above approximately 50 nM, where BioY alone shows higher transport activity than the complete complex . This pattern suggests that the BioMNY system is specifically adapted for efficient nutrient scavenging in biotin-limited environments, conditions that likely prevail in many natural bacterial habitats.

Interestingly, subcomplexes containing BioMY (without BioN) transport biotin essentially as efficiently as the complete BioMNY complex at both low and high substrate concentrations, suggesting functional interaction between BioM and BioY independent of BioN . Conversely, BioNY subcomplexes exhibit transport patterns more similar to BioY alone rather than the complete complex, indicating limited functional interaction between BioN and BioY in the absence of BioM. These findings collectively demonstrate that the response to different biotin concentrations is determined by specific protein-protein interactions within the transport complex.

What is the specific role of BioN in the BioMNY transporter complex compared to BioM and BioY?

Within the BioMNY transporter complex, each component serves distinct yet complementary functions in the biotin transport process. BioY is definitively identified as the central and substrate-binding component, capable of biotin transport even in the absence of BioM and BioN, albeit with lower affinity . BioM contains the ATPase domain that provides energy for high-affinity transport through ATP hydrolysis, as evidenced by the dramatic reduction in transport activity when the Walker A motif is mutated (K42N) .

The specific role of BioN is more nuanced. Experimental evidence indicates that BioN is not absolutely required for biotin transport, as BioMY subcomplexes (without BioN) can transport biotin with efficiency similar to the complete BioMNY complex across various biotin concentrations . This suggests that BioN may have a regulatory or stabilizing function rather than being directly involved in substrate translocation. Alternatively, BioN might facilitate optimal conformational changes in the complex during the transport cycle or enhance the assembly and structural integrity of the transporter in the membrane.

Interestingly, BioNY subcomplexes (without BioM) show transport activity similar to BioY alone rather than the complete complex, indicating that BioN's functional contribution is closely tied to the presence of BioM . This interdependence suggests a coordinated mechanism where BioN may serve as a physical and functional bridge between the energy-providing component (BioM) and the substrate-binding component (BioY), optimizing the coupling of ATP hydrolysis to substrate translocation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.