Recombinant Rhizobium etli Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rhizobium etli Membrane Protein Insertase YidC (yidC)

Recombinant Rhizobium etli Membrane Protein Insertase YidC (yidC) is a bacterially expressed protein derived from the Rhizobium etli genome. YidC is a universally conserved membrane insertase critical for the biogenesis of membrane proteins, facilitating their integration into lipid bilayers either independently or in conjunction with the Sec translocon . In Rhizobium etli, a nitrogen-fixing symbiotic bacterium, YidC plays a key role in membrane protein biogenesis, potentially influencing symbiotic interactions with leguminous plants . Recombinant YidC enables biochemical and structural studies to elucidate its mechanism in membrane protein insertion and folding .

Protein Features

  • Gene ID: 24301496 (NCBI) .

  • UniProt ID: Q2K9L0 .

  • Sequence: 244 amino acids, including conserved transmembrane domains (TMs) critical for insertase activity .

  • Recombinant Form: Produced in E. coli with a Tris-based storage buffer and >85% purity (SDS-PAGE) .

Functional Roles

YidC operates via two pathways:

  1. Sec-independent insertion: Direct integration of small membrane proteins (e.g., phage Pf3 coat protein) into lipid bilayers .

  2. Sec-associated folding: Collaborative action with the Sec translocon for complex membrane protein assembly .

In Rhizobium etli, YidC may assist in exporting symbiosis-related proteins, such as adhesins or flagellins, influenced by secondary messengers like cyclic diguanylate (cdG) .

Key Studies

  • Reconstitution Assays: Purified YidC proteoliposomes catalyze Pf3 coat protein insertion at a stoichiometric ratio of 1:150 (YidC:substrate) .

  • Post-Translational Regulation: Elevated cdG levels in R. etli enhance extracellular export of cytoplasmic "moonlighting" proteins (e.g., EF-Tu, Gap) via YidC-associated mechanisms .

  • Genomic Diversity: R. etli strains exhibit low homologous recombination but maintain conserved YidC functionality across lineages .

YidC in E. coli vs. Rhizobium etli

FeatureE. coli YidCRhizobium etli YidC
Primary RoleMembrane insertion of Sec-independent substrates (e.g., F0c, M13) Likely supports symbiosis-related membrane proteins
Structural MotifsFive TMs with a periplasmic domain Similar core structure, conserved TMs
Regulatory FactorsInteracts with YibN to enhance activity Post-translational modifications under cdG signaling

Applications and Implications

  • Biotechnology: Recombinant YidC aids in studying membrane protein biogenesis and engineering synthetic lipid-protein systems .

  • Agriculture: Insights into YidC’s role in Rhizobium etli symbiosis could optimize nitrogen-fixing efficiency in legumes .

  • Drug Development: YidC homologs in pathogens (e.g., E. coli) are potential antibiotic targets .

Challenges and Future Directions

  • Functional Redundancy: YidC’s overlap with Sec machinery complicates mechanistic studies .

  • Unresolved Questions:

    • How does YidC interact with cdG-regulated export pathways in R. etli?

    • What drives conformational changes during substrate insertion?

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
yidC; RHECIAT_CH0000478; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-598
Protein Length
full length protein
Species
Rhizobium etli (strain CIAT 652)
Target Names
yidC
Target Protein Sequence
MMENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKAQEAQKAQQQTEQVQQPAAGGATP APASGTAPSGQAVATATLEQALAKTPRVAIDTPALSGSINLAGARLDDLKLKGYHETVDD SSPIITLFSPAETKDGYFTELGYIGSDATGSVPGASTLWTAPEGAKLTEKTPVTLSYTND KGLTFTRTISVDERYMFTIADKVANTGQAPVSLSSYGRVTRYNKPTTPSAYVLHEGFIGV IGDDGLIESKYTAVEKEAVMPAKSTGGWLGITDKYWAATIVPPQASAYEARFSHFSDGQP RYQADYKDDAFTVAPGQSVELKNLVFAGAKEVPVIDGYEASYSIPRFDRLIDWGWFYFIT KPMFKLMDFFFRFFGNFGVAILCTTIVVKALFFPLASKQYASMANMKRMQPKMEELKAKF GDDRMGLQQATMQLYKEEKINPIAGCWPVALQIPIFFSLYKVIYITIEMRHAPFFGWIQD LSAPDPTTIVNLFGLLPFTAPTFLHLGVWPLIMGVTMFLQMRMNPTPPDPTQAMIFNWMP LVFMFMLASFPAGLVIYWAWNNTLSVIQQSVIMKRHGVKIELFDNLKGLFRRKTAPSK
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. YidC plays a role in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as some lipoproteins. It also facilitates the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its fundamental role in bacterial membrane protein insertion?

YidC is a membrane insertase that facilitates the integration and folding of membrane proteins into lipid bilayers. Unlike translocases that require additional components, YidC can function independently to catalyze the insertion of certain membrane proteins, particularly those with single transmembrane segments. In bacteria like Rhizobium etli, YidC plays a critical role in membrane protein biogenesis by providing a pathway for Sec-independent membrane protein insertion .

The insertase functions by creating a hydrophilic environment within the membrane that reduces the energetic barrier for translocating charged or polar amino acid residues through the hydrophobic membrane core. Structurally, YidC contains a cytoplasmic α-helical hairpin domain that initially binds substrate polypeptides and a hydrophilic groove that facilitates their transfer into the membrane . This sequential process involves:

  • Initial binding of the substrate polypeptide (within ~2 ms)

  • Strengthening of the binding and conformational adjustment (~52 ms)

  • Transfer of the substrate to a membrane-inserted, folded state

How does Rhizobium etli YidC relate to homologues in other organisms?

YidC belongs to a highly conserved family of membrane protein insertases found across all domains of life. Key homologues include:

Organism TypeHomologueCellular LocationFunctional Similarities
BacteriaYidCInner membraneIndependent insertase; SecYEG chaperone
MitochondriaOxa1pInner membraneInsertion of mitochondrially encoded proteins
ChloroplastsAlb3Thylakoid membraneIntegration of light-harvesting complexes

The conservation of these insertases across diverse organisms highlights their fundamental importance in cellular function . While sharing core mechanisms for membrane protein insertion, each homologue has evolved specialized adaptations for their respective cellular environments and substrate repertoires. In Rhizobium etli specifically, YidC functions are particularly relevant to symbiotic interactions and adaptations to the legume host environment .

What experimental systems are available for studying YidC function in Rhizobium etli?

Several experimental systems have been developed for investigating YidC function in R. etli:

In vivo systems:

  • Isogenic R. etli strains with modified cdG levels (e.g., strain LR101 with high cdG versus LR102 with physiological levels) for studying YidC regulation

  • Deletion mutants to assess YidC essentiality and identify specific phenotypes

  • Fluorescently tagged YidC constructs for localization studies

In vitro systems:

  • Proteoliposomes containing purified YidC for reconstitution experiments

  • Cell-free translation systems supplemented with YidC-containing membranes

  • Single-molecule force spectroscopy combined with fluorescence spectroscopy for real-time monitoring of YidC-substrate interactions

These systems enable researchers to study YidC from multiple perspectives, from molecular mechanisms to physiological functions in symbiotic contexts.

What are the optimal protocols for purifying functional Rhizobium etli YidC?

Purification of functional R. etli YidC requires careful consideration of detergent selection and buffer conditions to maintain the protein's native conformation. A recommended protocol includes:

  • Overexpression system preparation:

    • Clone the yidC gene from R. etli genomic DNA into an expression vector with a C-terminal His-tag

    • Transform into an E. coli expression strain optimized for membrane proteins

    • Induce expression at lower temperatures (18-20°C) to improve proper folding

  • Membrane isolation:

    • Harvest cells and disrupt by French press or sonication

    • Remove unbroken cells and debris by low-speed centrifugation

    • Isolate membrane fraction through ultracentrifugation at 100,000×g for 1h

  • Solubilization and purification:

    • Solubilize membranes in buffer containing mild detergents like n-dodecyl-β-D-maltopyranoside (DDM)

    • Apply to Ni-NTA affinity chromatography

    • Wash extensively and elute with imidazole gradient

    • Further purify by size exclusion chromatography

  • Quality assessment:

    • Confirm purity by SDS-PAGE and western blotting

    • Verify functionality through reconstitution assays with model substrates like Pf3 coat protein

Maintaining the cold chain throughout purification and inclusion of stabilizing agents such as glycerol improves recovery of functional protein.

How can researchers assess YidC-mediated membrane insertion activity?

Several complementary approaches can quantitatively measure YidC-mediated insertion activity:

Reconstitution assays:

  • Reconstitute purified YidC into proteoliposomes

  • Add in vitro synthesized substrate proteins (e.g., Pf3 coat protein)

  • Assess insertion by protease protection assays - properly inserted proteins will be protected from externally added proteases

Fluorescence-based assays:

  • Label substrate proteins with environmentally sensitive fluorophores

  • Monitor changes in fluorescence intensity or lifetime upon membrane insertion

  • This allows real-time tracking of insertion kinetics with high sensitivity

Single-molecule force spectroscopy:
This advanced technique combines atomic force microscopy with fluorescence detection to monitor insertion events at the single-molecule level, providing insights into:

  • Binding kinetics (observed within 2 ms)

  • Conformational changes during substrate processing (within 52 ms)

  • Forces required for insertion and extraction

What methods can be used to investigate the interaction between YidC and substrate proteins?

Understanding YidC-substrate interactions requires approaches that capture both stable and transient interactions:

  • Crosslinking studies:

    • Chemical crosslinkers with different arm lengths can identify residues in proximity

    • Photo-activatable crosslinkers allow temporal control of crosslinking

    • Analysis by mass spectrometry reveals interaction sites

  • Surface plasmon resonance (SPR):

    • Immobilize YidC on sensor chips

    • Flow substrate proteins and measure binding kinetics

    • Determine association and dissociation rate constants

  • Combined spectroscopy approaches:

    • Single-molecule force spectroscopy and fluorescence spectroscopy allow simultaneous tracking of binding and conformational changes

    • This reveals the mechanism where YidC's cytoplasmic α-helical hairpin binds substrates with high conformational variability and then transfers them to a membrane-inserted state with low conformational variability

  • Molecular dynamics simulations:

    • Both equilibrium and non-equilibrium MD simulations help elucidate atomic-level mechanisms

    • These computational approaches complement experimental data and provide insights into transient states difficult to capture experimentally

How does cyclic diguanylate (c-di-GMP) signaling regulate YidC function in Rhizobium etli?

The second messenger c-di-GMP significantly impacts membrane protein composition in R. etli, affecting YidC-mediated insertion processes. Research approaches addressing this question include:

  • Comparative proteomic analysis:

    • Quantify extracellular and membrane proteomes in strains with varying c-di-GMP levels

    • Both 2D-GE and iTRAQ-labeling proteomics reveal differential protein abundances

    • Data shows that elevated c-di-GMP levels in R. etli strain LR101 alter the abundance of numerous membrane and extracellular proteins compared to strain LR102 with physiological c-di-GMP levels

  • Analysis of specific substrate classes:

    • Adhesins: RapAch shows increased abundance (IA) while RapB1/B2 show reduced abundance (RA) with elevated c-di-GMP

    • Flagellins: Several flagellins (FlaCch2-5, FlaCe) and flagellar hook-related proteins show increased abundance despite c-di-GMP inhibiting motility

  • Post-translational modification analysis:

    • Investigate whether c-di-GMP influences post-translational modifications of YidC substrates

    • Examine if c-di-GMP alters YidC partner interactions or substrate selectivity

    • Techniques include mass spectrometry to identify modifications and immunoprecipitation to detect protein interactions

The evidence suggests c-di-GMP creates a coordinated response that includes both expected changes (increased adhesins for biofilm formation) and unexpected ones (selective export of cytoplasmic proteins) .

What is the molecular mechanism of YidC-mediated Pf3 coat protein insertion?

The insertion of Pf3 coat protein by YidC serves as a model system for understanding insertase mechanisms. Current research indicates a multi-step process:

  • Initial substrate recognition:

    • YidC's cytoplasmic α-helical hairpin binds the Pf3 polypeptide within 2 ms

    • This initial binding exhibits high conformational variability but significant kinetic stability

  • Strengthening phase:

    • Within 52 ms, YidC strengthens its binding to Pf3

    • This involves conformational adjustments to accommodate the substrate

  • Transfer and insertion:

    • YidC uses both its cytoplasmic α-helical hairpin domain and hydrophilic groove to guide Pf3 into the membrane

    • The hydrophilic groove provides a protected environment that reduces the energetic barrier for insertion

  • Final folded state:

    • Once inserted, Pf3 adopts a transmembrane α-helical conformation with low conformational variability

    • This represents the completion of the insertion process

Notably, a Pf3 mutant with an extended hydrophobic region can insert independently of YidC both in vivo and in vitro, though YidC accelerates this process. This finding highlights YidC's role in overcoming the energetic barrier of transferring less hydrophobic segments across the membrane .

How does YidC interact with the SecYEG translocon and other membrane biogenesis factors?

YidC functions both independently and in cooperation with the SecYEG translocon. Research approaches to investigate these interactions include:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify stable interaction partners

    • Bacterial two-hybrid assays to map interaction domains

    • Crosslinking studies to capture transient interactions during substrate handoff

  • Functional complementation analysis:

    • Assess which SecYEG-dependent substrates require YidC assistance

    • Determine whether certain YidC-dependent substrates can be rerouted through SecYEG

    • Example: YidC plays a critical role in the insertion of LacY lactose permease via the SecYEG complex; deletion of YidC results in conformational changes during LacY insertion

  • Substrate specificity determinants:

    • Compare substrate profiles from proteomics studies

    • Identify sequence or structural features that determine routing to YidC versus SecYEG pathways

    • YidC is particularly important for small phage coat proteins like Pf3 and M13 in a Sec-independent pathway

Additionally, YidC participates in the incorporation of subunit II of cytochrome o oxidase in E. coli, highlighting its role in complex membrane protein assembly .

How should researchers interpret proteomic data related to YidC function in Rhizobium etli?

Proteomic analysis of YidC function presents several challenges that require careful interpretation:

  • Multiple proteoforms identification:

    • The same protein may appear in multiple 2D-GE spots with different abundance patterns

    • Example: Hypothetical protein RHE_CH00301 was identified in 10 separate spots - 6 with increased abundance and 4 with reduced abundance in high c-di-GMP conditions

    • Glyceraldehyde 3-phosphate dehydrogenase appeared in 4 spots, 3 showing increased and 1 showing decreased abundance

  • Recommended analysis workflow:

    • Start with global proteome changes to identify patterns

    • Focus on specific protein groups (adhesins, flagellins, etc.)

    • Verify proteomic findings with targeted approaches (western blots, activity assays)

    • Consider post-translational modifications as a source of multiple proteoforms

  • Interpretation framework:

    • Direct vs. indirect effects: Determine whether changes reflect direct YidC substrates or downstream effects

    • Regulatory networks: Integrate proteomic data with transcriptomic and metabolomic data

    • Evolutionary context: Compare findings across related rhizobial species

When analyzing proteomic data related to YidC function, researchers should be aware that approximately 50% of cytoplasmic proteins showing differential abundance have been described as moonlighting proteins in other organisms, suggesting complex regulatory networks beyond the canonical insertion pathway .

What computational approaches can enhance understanding of YidC mechanism?

Computational methods provide valuable insights into YidC function that complement experimental approaches:

  • Molecular dynamics simulations:

    • Equilibrium MD simulations capture the stable states of YidC-substrate complexes

    • Non-equilibrium MD simulations reveal transient states during insertion

    • These approaches help elucidate the mechanism at atomic resolution

  • Integrative structural modeling:

    • Combine data from multiple experimental sources (cryo-EM, crosslinking, FRET)

    • Generate molecular models of the complete insertion process

    • Predict effects of mutations on insertion efficiency

  • Machine learning applications:

    • Develop algorithms to predict YidC-dependent substrates based on sequence features

    • Identify patterns in proteomic data that may reveal regulatory principles

    • Model the relationship between c-di-GMP signaling and YidC-mediated insertion

These computational approaches are particularly valuable for capturing the dynamic nature of insertion processes that occur on millisecond timescales and involve transient interactions that are challenging to study experimentally .

How can researchers resolve contradictory findings about YidC substrates in different bacterial systems?

The field of YidC research sometimes presents contradictory findings about substrate specificity and function between different bacterial species. Methodological approaches to resolve these contradictions include:

  • Standardized experimental systems:

    • Develop unified protocols for YidC purification and activity assays

    • Create a panel of model substrates to test across bacterial species

    • Standardize analytical methods for comparing results

  • Phylogenetic analysis:

    • Compare YidC sequences and structures across bacterial lineages

    • Identify conserved versus divergent domains

    • Correlate functional differences with structural variations

  • Heterologous expression studies:

    • Express YidC from different bacterial species in a common host

    • Test insertion of standardized substrates

    • Identify species-specific versus universal substrate recognition principles

  • Systematic review methodology:

    • Document experimental conditions in published studies

    • Identify variables that may account for contradictory results

    • Develop consensus models that incorporate contextual factors

When comparing findings between R. etli and other bacteria such as E. coli, researchers should consider the distinctive physiological context of symbiotic bacteria and their adaptation to specific plant hosts .

What emerging technologies will advance YidC research in symbiotic bacteria?

Several cutting-edge technologies are poised to transform our understanding of YidC function in R. etli and other symbiotic bacteria:

  • Cryo-electron tomography:

    • Visualize YidC-mediated insertion in intact bacterial cells

    • Capture the spatial organization of insertion sites within the cell envelope

    • Map YidC distribution during different stages of symbiosis

  • Time-resolved mass spectrometry:

    • Monitor insertion events with millisecond time resolution

    • Identify transient interaction partners during substrate processing

    • Quantify post-translational modifications in real-time

  • Synthetic biology approaches:

    • Engineer YidC variants with expanded or altered substrate specificity

    • Develop biosensors that report on YidC activity in living cells

    • Create minimal insertion systems for fundamental mechanistic studies

  • Advanced computational methods:

    • Apply AlphaFold-based structure prediction to model YidC-substrate complexes

    • Develop neural networks that integrate multi-omics data to predict YidC function

    • Simulate insertion processes across multiple timescales

These technologies will help bridge the gap between molecular mechanisms and physiological functions of YidC in the context of plant-bacterial symbiosis .

How might YidC research impact our understanding of legume-rhizobia symbiosis?

YidC plays a crucial role in membrane protein biogenesis, which directly impacts symbiotic processes in several ways:

  • Signaling protein insertion:

    • Proper insertion of receptors for plant-derived signals

    • Integration of transporters for nutrient exchange

    • Assembly of secretion systems for symbiotic factors

  • Adaptation to host microenvironments:

    • Remodeling of the membrane proteome during nodule colonization

    • Response to oxygen limitation in nodules

    • Adaptation to plant immune responses

  • Integration with c-di-GMP signaling:

    • C-di-GMP regulates biofilm formation and motility during root colonization

    • YidC functions appear to be coordinated with c-di-GMP signaling networks

    • This integration may optimize membrane composition for different stages of symbiosis

Understanding YidC function in R. etli could lead to engineering improved symbiotic efficiency and enhanced nitrogen fixation capacity, with significant agricultural implications .

What are the key unanswered questions about YidC structural dynamics during insertion?

Despite recent advances, several fundamental questions about YidC structural dynamics remain unanswered:

  • Conformational changes during the insertion cycle:

    • How does YidC's structure change upon substrate binding?

    • What conformational transitions facilitate substrate transfer to the membrane?

    • How is the insertion cycle reset after substrate release?

  • Substrate recognition principles:

    • What features distinguish YidC-dependent from SecYEG-dependent substrates?

    • How does YidC accommodate diverse substrate topologies?

    • Is there a specific binding site or a more general interaction surface?

  • Energy coupling mechanisms:

    • How is the energetic barrier of insertion overcome?

    • What role does the membrane potential play in YidC function?

    • Are there ATP-dependent steps in the insertion cycle?

  • Regulatory mechanisms:

    • How is YidC activity modulated in response to cellular stress?

    • What governs the balance between independent YidC function versus SecYEG cooperation?

    • How do post-translational modifications affect YidC activity?

Addressing these questions will require integrating structural biology with functional assays and computational approaches, potentially revealing new principles of membrane protein biogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.