Recombinant Rhizobium etli Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mtgA; RHECIAT_CH0004300; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Rhizobium etli (strain CIAT 652)
Target Names
mtgA
Target Protein Sequence
MPARRRWFENRPMLKRIVLAVLALVILPYVLIFFYLLPFIHPVSTLMLRDLVLLRGYDRR WVSLDQISPALVQSVMMSEDGQYCFHGGVDWAEMRMLVEDTLKGQATRGGSTIPMQTAKN LFLWNSRSFVRKAMELPLAVSTDFVLSKRRLMEIYLNIAEWGPGIYGVEAAAQHHFKVPA SKLTRRQASLLAVSLPNPIDRNAGKPGRGLRRLAGVIERRAQGSGEYIKCIYE
Uniprot No.

Target Background

Function
Recombinant *Rhizobium etli* Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

Advanced Research Questions

  • What role might mtgA play in R. etli's symbiotic relationship with leguminous plants?

    While direct evidence for mtgA's role in symbiosis remains limited, several lines of evidence suggest potential significance:

    • Cell wall remodeling is crucial during bacterial infection and nodule formation in the R. etli-Phaseolus vulgaris symbiosis

    • Peptidoglycan synthesis enzymes may be differentially regulated during the transition from free-living to symbiotic states

    • The bacterial cell wall must withstand osmotic challenges within the plant cell environment

    • Proper peptidoglycan structure may influence recognition by plant immune receptors, potentially impacting symbiotic compatibility

    Experimental approaches to investigate this question could include:

    1. Generating mtgA knockout or conditional mutants in R. etli and assessing their symbiotic capabilities

    2. Monitoring mtgA expression during different stages of nodulation using transcriptomics

    3. Examining whether mtgA interacts with other symbiosis-related proteins through co-immunoprecipitation or bacterial two-hybrid assays

    This represents an important gap in current research, as most studies of R. etli symbiosis have focused on nitrogen fixation genes rather than cell wall biogenesis factors .

  • How does the transmembrane segment of mtgA impact its enzymatic function?

    The transmembrane (TM) segment of glycosyltransferases, including mtgA, plays crucial roles beyond simple membrane anchoring:

    1. Enhanced enzymatic activity: Full-length MtgA with intact TM segments shows significantly higher glycosyltransferase activity compared to truncated forms lacking the TM domain

    2. Substrate binding: The TM segment likely influences interaction with lipid II substrates, which are anchored in the membrane

    3. Product length determination: In Streptococcus pneumoniae PBP2a, the TM segment influences glycan chain length in the final peptidoglycan product

    4. Protein-protein interactions: The TM domain facilitates interactions with other membrane proteins involved in cell wall synthesis

    Experimental evidence from E. coli MtgA indicates that interaction with the divisome protein PBP3 requires the transmembrane segment, as demonstrated by bacterial two-hybrid experiments using truncated constructs . This suggests the TM domain of R. etli mtgA may similarly mediate protein-protein interactions essential for coordinated cell wall synthesis.

  • What interactions might exist between R. etli mtgA and other cell division proteins?

    By extrapolating from studies of E. coli MtgA, we can hypothesize potential interaction partners for R. etli mtgA:

    Likely Interaction Partners:

    1. PBP3 (FtsI): In E. coli, MtgA directly interacts with PBP3, a transpeptidase essential for septal peptidoglycan synthesis. Bacterial two-hybrid assays showed this interaction produces β-galactosidase activity 10-fold higher than controls

    2. FtsW: MtgA strongly interacts with FtsW, with interaction strength 37-fold higher than controls. FtsW is implicated in lipid II transport and is essential for cell division

    3. FtsN: MtgA interacts with FtsN (20-fold higher signal than controls), which coordinates peptidoglycan synthesis activities during division

    4. Self-interaction: MtgA can interact with itself (37-fold higher signal), suggesting possible dimerization or higher-order complex formation

    These interactions suggest mtgA likely functions within a multiprotein complex during cell division. R. etli homologs of these division proteins likely form similar interactions, though experimental verification is needed.

  • How do mutations in mtgA affect bacterial fitness and cell wall integrity in R. etli?

    While specific studies on R. etli mtgA mutations are lacking, insights can be drawn from related research:

    1. Potential compensatory mechanisms: In E. coli, MtgA can partially compensate for the absence of bifunctional PBPs (PBP1a and PBP1b) during cell division, localizing to the division site when these proteins are absent or defective

    2. Impact on cell morphology: Alterations in peptidoglycan synthesis enzymes typically result in changes to bacterial cell shape, division abnormalities, or increased sensitivity to cell wall-targeting antibiotics

    3. Stress response effects: Given R. etli's adaptation to stressful conditions (low pH, high temperatures) , mtgA mutations might compromise stress resistance

    4. Symbiotic phenotypes: Defects in cell wall biosynthesis could potentially impact infection thread formation and nodule development during symbiosis

    A methodical approach to studying mtgA mutations would include:

    • Creating defined mutations (point mutations, deletions, conditional expression)

    • Phenotypic characterization under free-living and symbiotic conditions

    • Cell wall composition analysis using HPLC and mass spectrometry

    • Complementation studies with wild-type and mutant variants

  • What techniques can be used to investigate the localization of mtgA during the R. etli cell cycle?

    Several advanced microscopy and biochemical techniques can reveal the spatial and temporal dynamics of mtgA:

    Fluorescence Microscopy Approaches:

    1. GFP-fusion proteins: Creating mtgA-GFP fusions allows visualization of protein localization during cell division. In E. coli, GFP-MtgA was shown to localize to mid-cell in strains deficient in PBP1b with a thermosensitive PBP1a

    2. Time-lapse microscopy: Tracking dynamic changes in mtgA localization throughout the cell cycle

    3. Super-resolution techniques: PALM, STORM or STED microscopy for nanometer-scale resolution of mtgA distribution

    Biochemical Approaches:

    1. Membrane fractionation: Separating cell poles from mid-cell regions to quantify mtgA distribution

    2. Co-immunoprecipitation: Identifying interacting proteins at different cell cycle stages

    3. Crosslinking studies: Capturing transient interactions with divisome components

    Validation Methods:

    1. Controls for functionality: Verify that tagged mtgA retains enzymatic activity (as demonstrated for GFP-MtgA in E. coli, where a 2.4-fold increase in peptidoglycan polymerization was observed)

    2. Genetic complementation: Ensure tagged constructs complement mtgA mutant phenotypes

  • How does environmental stress affect R. etli mtgA expression and function?

    R. etli thrives under various stressful conditions including acidic soil environments and high temperatures . Peptidoglycan remodeling likely plays a role in stress adaptation:

    Potential Regulatory Mechanisms:

    1. Transcriptional control: The R. etli mtgA promoter might be recognized by sigma factors induced during stress responses. R. etli contains a large number of sigma factors (one housekeeping σ70 gene, two copies of rpoH, two copies of rpoN, and 18 genes of the extracytoplasmic factor group)

    2. Post-transcriptional regulation: mRNA stability or translational efficiency might be modulated under stress

    3. Protein-level regulation: Activity might be controlled through protein-protein interactions or post-translational modifications

    Methodological Approaches:

    1. Gene expression analysis: RT-qPCR or RNA-seq to monitor mtgA expression under various stresses (temperature, pH, oxidative stress)

    2. Reporter gene fusions: Constructing mtgA promoter-reporter fusions to visualize expression changes

    3. Protein activity assays: Measuring transglycosylase activity under different environmental conditions

    4. Stress sensitivity phenotyping: Testing how mtgA mutations affect survival under stress

    Given R. etli's adaptability to diverse environmental conditions, understanding how peptidoglycan synthesis enzymes respond to stress could reveal important adaptation mechanisms in this agriculturally important symbiont.

Methodological Notes

For researchers working with R. etli mtgA, consider these practical recommendations:

  • When storing the recombinant protein, aliquot to avoid repeated freeze-thaw cycles which reduce activity

  • For optimal activity assays, ensure proper buffer composition including divalent cations (Ca²⁺) which enhance glycosyltransferase function

  • When creating fusion proteins for localization studies, place tags at positions less likely to interfere with the transmembrane domain or active site

  • Consider the native regulation of mtgA when designing expression constructs for complementation studies

  • For evolutionary studies, compare the R. etli mtgA sequence with homologs from both closely related rhizobia and more distant bacterial species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.