Recombinant Rhizobium etli NADH-quinone oxidoreductase subunit K 1 (nuoK1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply for this service.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
nuoK1; RHECIAT_CH0001687; NADH-quinone oxidoreductase subunit K 1; NADH dehydrogenase I subunit K 1; NDH-1 subunit K 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Rhizobium etli (strain CIAT 652)
Target Names
nuoK1
Target Protein Sequence
MVIGLSHYLTVSAILFTLGVFGIFLNRKNVIVILMSVELILLSVNINMVAFSHFLNDIVG QVFALFILTVAAAEAAIGLAILVVFYRNRGSIAVEDVNMMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this specific species, the primary electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction to proton translocation, transporting four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase in Rhizobium etli and what is its function?

NADH-quinone oxidoreductase (also known as Complex I) is a crucial enzyme in the respiratory chain of Rhizobium etli, functioning as the entry point for electrons into the respiratory chain. This multi-subunit enzyme complex catalyzes the transfer of electrons from NADH to quinone, coupled with proton translocation across the membrane, contributing to the generation of a proton motive force used for ATP synthesis. In Rhizobium etli, this enzyme plays a vital role in energy metabolism during both free-living and symbiotic stages with host plants like Phaseolus vulgaris (common bean).

The enzyme's activity is particularly important during nodule formation and nitrogen fixation processes, as these are energetically demanding processes. Research suggests that NADH-quinone oxidoreductase activity may be regulated differently under symbiotic conditions compared to free-living conditions, reflecting the bacterium's adaptation to different metabolic requirements .

How does the structure of nuoK1 relate to its function in the NADH-quinone oxidoreductase complex?

The nuoK1 subunit is one of the membrane-embedded components of the NADH-quinone oxidoreductase complex, believed to be involved in proton translocation across the bacterial membrane. Although specific structural data for Rhizobium etli nuoK1 is limited, comparative analysis with homologous subunits suggests it contains multiple transmembrane helices that form part of the proton channel within the complex.

The subunit likely contributes to the conformational changes that couple electron transfer with proton pumping. Research into similar bacterial systems suggests that mutations in the nuoK subunit can significantly alter proton pumping efficiency without necessarily affecting electron transfer, indicating its specific role in the proton translocation machinery rather than electron transport directly.

What methodologies are recommended for isolating nuoK1 from Rhizobium etli for laboratory studies?

Isolation of nuoK1 from Rhizobium etli requires careful consideration of its membrane-embedded nature. A recommended protocol involves:

  • Cultivation of Rhizobium etli under appropriate conditions (usually 28-30°C in YEM medium)

  • Cell harvesting and disruption using either French press or sonication in buffer containing protease inhibitors

  • Differential centrifugation to isolate membrane fractions

  • Solubilization of membrane proteins using gentle detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin

  • Affinity chromatography if working with tagged recombinant proteins

  • Size exclusion chromatography for final purification

For recombinant expression, E. coli-based systems with specialized membrane protein expression strains (such as C41/C43) often yield better results than standard expression strains. Codon optimization for E. coli expression is recommended when working with Rhizobium etli genes due to potential codon usage differences .

What expression systems are most effective for producing recombinant Rhizobium etli nuoK1?

Based on research with similar membrane proteins from Rhizobium etli, the following expression systems have demonstrated effectiveness for nuoK1 and related subunits:

Expression SystemAdvantagesLimitationsYield
E. coli C41(DE3)Specialized for membrane proteins, reduced toxicityMay require codon optimizationModerate (0.5-2 mg/L)
E. coli LEMO21(DE3)Tunable expression, reduced inclusion bodiesComplex optimization requiredVariable (0.3-3 mg/L)
Rhizobium-based systemsNative folding environmentLower yields, more complex manipulationLow (0.1-0.5 mg/L)

For optimal expression in E. coli systems, consider these parameters:

  • Induction at lower temperatures (16-20°C)

  • Extended expression times (16-24 hours)

  • Lower inducer concentrations (0.1-0.2 mM IPTG)

  • Supplementation with iron sources if working with Fe-S cluster-containing subunits

Addition of a small solubility tag (such as His6) at either the N- or C-terminus facilitates purification while minimizing interference with protein folding. For membrane proteins like nuoK1, C-terminal tags often perform better as N-terminal sequences may contain important targeting information.

What challenges might researchers encounter when working with recombinant nuoK1 and how can they be addressed?

Researchers working with recombinant nuoK1 frequently encounter several challenges:

  • Low expression levels: Optimize by testing different promoters, host strains, and expression conditions. Use specialized membrane protein expression strains like C41/C43.

  • Protein misfolding: Add molecular chaperones (GroEL/ES) as co-expression partners. Reduce expression rate by lowering temperature and inducer concentration.

  • Inclusion body formation: Employ mild solubilization strategies with specific detergents like DDM or LMNG. Consider refolding protocols if inclusion bodies cannot be avoided.

  • Protein instability: Include stabilizing agents in purification buffers (glycerol 10-20%, specific lipids). Minimize temperature fluctuations and freeze-thaw cycles.

  • Loss of activity: Maintain native lipid environment by using gentler extraction methods or nanodiscs/liposomes for functional studies after purification.

Research with related oxidoreductase subunits suggests that maintaining a reducing environment throughout purification helps preserve any redox-sensitive cofactors that may be present in the protein complex.

How can researchers effectively analyze gene conversion events in the nuoK1 gene of Rhizobium etli?

Gene conversion, a form of non-reciprocal transfer of genetic information during homologous recombination, can be analyzed in nuoK1 using methodologies similar to those employed in studies of other Rhizobium etli genes. A recommended approach involves:

  • Construction of a two-plasmid system where each plasmid carries a copy of nuoK1

  • Modification of one nuoK1 copy to create restriction fragment length polymorphisms (RFLPs) along the gene

  • Introduction of the modified plasmid into R. etli

  • Selection for cointegration with the resident plasmid

  • Analysis of resulting molecules for gene conversion events

This approach has been successfully used to study gene conversion in the nitrogenase (nifH) gene family of Rhizobium etli, revealing that gene conversion is biased toward certain patterns of genetic exchange. Research indicates that gene conversion bias is caused by preferential double-strand breaks on one of the recombining homologs, which can be experimentally manipulated by introducing specific cleavage sites (like SceI sites) and expressing the corresponding meganuclease .

What methods are most reliable for creating site-directed mutations in nuoK1 to study structure-function relationships?

For creating precise mutations in nuoK1 to study structure-function relationships, researchers should consider these methodologies:

  • QuikChange Mutagenesis: Ideal for simple substitutions but becomes less efficient with increasing plasmid size

  • Gibson Assembly: Effective for multiple or complex mutations, allowing seamless junction creation

  • CRISPR-Cas9 Genome Editing: For direct chromosomal modifications without intermediate cloning steps

When designing mutagenesis experiments for membrane proteins like nuoK1, consider these research-backed principles:

  • Target conserved residues identified through multiple sequence alignments across bacterial species

  • Focus on charged residues within transmembrane regions, which often play critical roles in proton translocation

  • Create conservative substitutions first (e.g., Asp to Glu) before more disruptive changes

  • Include controls where non-functional positions are mutated to verify specificity of observed effects

After mutagenesis, verification should include both DNA sequencing and protein expression analysis to ensure the mutation hasn't affected protein stability or expression levels.

What approaches can researchers use to assess the electron transport activity of nuoK1 in the NADH-quinone oxidoreductase complex?

Assessing electron transport activity involving nuoK1 requires specialized techniques due to its integration within a multi-subunit membrane complex. Recommended methodologies include:

  • Membrane Potential Measurements: Using potential-sensitive fluorescent dyes like DiSC3(5) or TMRM to monitor proton translocation activity.

  • Oxygen Consumption Assays: Measuring oxygen uptake rates using oxygen electrodes (Clark-type) with NADH as substrate in isolated membrane vesicles.

  • Artificial Electron Acceptor Assays: Monitoring the reduction of artificial electron acceptors like ferricyanide or dichlorophenolindophenol (DCPIP) spectrophotometrically.

  • Reconstitution Studies: Incorporating purified components into proteoliposomes to assess defined activities under controlled conditions.

When designing experiments to assess nuoK1 function, it's important to include appropriate controls:

  • Wild-type enzyme complex for comparison

  • Specific inhibitors (rotenone, piericidin A) to confirm Complex I-specific activity

  • Uncouplers (CCCP, valinomycin) to distinguish electron transport from proton translocation

How can researchers investigate the role of nuoK1 in the symbiotic relationship between Rhizobium etli and host plants?

Investigating the role of nuoK1 in symbiosis requires approaches that bridge molecular and symbiotic phenotypes:

  • Construction of nuoK1 Mutants: Create deletion or point mutations using homologous recombination or CRISPR-Cas9 techniques.

  • Nodulation Assays: Inoculate host plants (particularly Phaseolus vulgaris) with wild-type and mutant strains to compare:

    • Nodule number and morphology

    • Timing of nodule formation

    • Nitrogen fixation capacity (acetylene reduction assay)

    • Plant growth parameters

  • Microscopy Analysis: Examine bacteroid differentiation and nodule ultrastructure using:

    • Transmission electron microscopy to assess bacteroid morphology

    • Fluorescence microscopy with tagged proteins to track nuoK1 localization

    • Histochemical staining to assess metabolic activity

  • Transcriptomic Analysis: Compare gene expression patterns between wild-type and mutant strains under free-living and symbiotic conditions to identify regulatory networks affected by nuoK1 function.

Research on Rhizobium etli symbiosis has demonstrated that nodules constitute a unique environment where bacteria can exchange genetic material, potentially affecting the expression and function of respiratory chain components like NADH-quinone oxidoreductase . This suggests that the role of nuoK1 may be influenced not only by the bacterium's genome but also by horizontal gene transfer events occurring within nodules.

How does the presence of multiple NADH-quinone oxidoreductase subunit variants in Rhizobium etli affect metabolic versatility?

Rhizobium etli possesses multiple variants of certain respiratory chain components, potentially including NADH-quinone oxidoreductase subunits like nuoK. This genetic redundancy likely contributes to metabolic versatility across different environmental conditions:

  • Oxygen Adaptation: Different subunit variants may be optimized for high-oxygen (free-living) versus low-oxygen (nodule) environments, allowing fine-tuned respiratory activity.

  • Carbon Source Utilization: Variant expression may change based on available carbon sources, optimizing energy production efficiency under different nutritional states.

  • Stress Response: Some variants may provide enhanced function under stress conditions (pH, temperature, oxidative stress) encountered during host infection.

Research methodologies to investigate these variations include:

  • Targeted proteomics to quantify relative abundance of different subunit variants under varying conditions

  • Construction of variant-specific deletion mutants to assess their contribution to fitness in different environments

  • Transcriptional reporter fusions to monitor expression patterns of variant genes

Differential regulation of respiratory chain components appears to be a common adaptation strategy in rhizobia, allowing them to thrive both as free-living soil bacteria and as intracellular symbionts .

What computational approaches are most valuable for predicting nuoK1 structure and interactions?

For membrane proteins like nuoK1 where experimental structural determination is challenging, computational approaches offer valuable insights:

Computational MethodApplicationAdvantagesLimitations
Homology ModelingBasic structure predictionUses solved structures of homologous proteinsAccuracy depends on template similarity
Molecular DynamicsDynamics and interactionsProvides insight into conformational changesComputationally intensive, force field limitations
Coevolution AnalysisPredicting residue contactsCan identify functionally coupled residuesRequires large, diverse sequence datasets
Ab initio ModelingNovel fold predictionDoes not require homologous templatesLess reliable for large proteins
Protein-Protein DockingSubunit assembly modelingPredicts interfaces between complex componentsChallenge to incorporate membrane environment

When applying these methods to nuoK1, researchers should:

  • Begin with multiple sequence alignment across diverse bacterial species to identify conserved regions

  • Use homology modeling based on solved structures of NADH-quinone oxidoreductase from model organisms

  • Refine models in explicit membrane environments using molecular dynamics

  • Validate computational predictions with experimental approaches like cross-linking or mutagenesis

Recent advances in AlphaFold and RoseTTAFold have significantly improved membrane protein structure prediction, making these approaches particularly valuable for proteins like nuoK1 where experimental structures are lacking.

How might horizontal gene transfer in nodules affect the evolution of NADH-quinone oxidoreductase genes in Rhizobium etli?

Recent research has demonstrated that nodules constitute a propitious environment for the exchange of genetic information among bacteria, beyond their primary function as structures for nitrogen fixation . This finding has significant implications for the evolution of respiratory chain components like NADH-quinone oxidoreductase:

  • Genetic Exchange Mechanisms: Studies have shown that the symbiotic plasmid (pSym) of Rhizobium etli CFN42 can transfer to various endophytic bacteria within nodules, including genera such as Stenotrophomonas, Achromobacter, and Bacillus .

  • Evolutionary Consequences: This horizontal gene transfer may lead to:

    • Acquisition of novel subunit variants with altered properties

    • Creation of hybrid complexes with enhanced or modified function

    • Spread of adaptive mutations across bacterial populations

  • Research Approaches: To investigate this phenomenon specifically for nuoK1, researchers could:

    • Monitor transfer of tagged nuoK1 genes in mixed bacterial populations within nodules

    • Perform comparative genomic analysis of nuoK1 sequences across rhizobia isolated from the same ecological niches

    • Assess functionality of horizontally transferred genes in recipient organisms

The finding that endophytic bacteria can acquire symbiotic capabilities through gene transfer opens intriguing possibilities for the evolution of metabolic pathways, including the respiratory chain components like NADH-quinone oxidoreductase .

What role might nuoK1 play in the bioenergetics of bacteroids during nitrogen fixation?

The bioenergetics of bacteroids (the differentiated form of rhizobia within nodules) during nitrogen fixation presents unique challenges that may involve specialized functions of respiratory chain components like nuoK1:

  • Microaerobic Adaptation: Nitrogenase is oxygen-sensitive, requiring bacteroids to maintain low oxygen levels while still generating sufficient ATP. nuoK1 may contribute to:

    • Fine-tuned oxygen consumption rates

    • Maintenance of membrane potential under microaerobic conditions

    • Balanced electron flow between nitrogen fixation and respiration

  • Alternative Electron Pathways: During symbiosis, bacteroids may employ alternative electron transport pathways where nuoK1 (or variant forms) could play specialized roles.

  • Energy Conservation: The high ATP demand of nitrogen fixation requires efficient energy conservation mechanisms, potentially involving modified proton translocation through subunits like nuoK1.

Research approaches to investigate these functions include:

  • Comparative proteomics of free-living cells versus bacteroids to identify differential subunit composition

  • Membrane potential measurements in isolated bacteroids with wild-type versus modified nuoK1

  • Metabolic flux analysis to trace electron flow through respiratory complexes during nitrogen fixation

Electron microscopy studies have revealed that bacteroids contain abundant polyhydroxybutyrate (PHB)-like storage material, suggesting unique metabolic adaptations that may involve specialized respiratory chain components .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.