Recombinant Rhizobium etli NADH-quinone oxidoreductase subunit K 2 (nuoK2)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Rhizobium etli NADH-quinone oxidoreductase subunit K 2 (nuoK2) is a protein engineered for research applications, produced by cloning and expressing the nuoK2 gene in heterologous systems such as Escherichia coli. This enzyme is part of the respiratory chain, catalyzing electron transfer from NADH to quinones, critical for cellular energy metabolism .

Biochemical Characteristics

  • Function: Acts as a component of the type II NADH:quinone oxidoreductase (NDH-2) family, which facilitates the oxidation of NADH and reduction of quinones without energy-transducing proton pumping .

  • Structure:

    • Monotopic membrane protein with a single subunit .

    • Contains a flavin adenine dinucleotide (FAD) cofactor for redox activity .

  • Catalytic Activity:

    • Substrates: NADH and quinones (e.g., ubiquinone, menadione) .

    • Optimal pH: Varies by organism; studies on homologs suggest activity across a broad pH range .

Functional Roles in Metabolism

  • NAD+ Regeneration: Essential for maintaining cellular NAD+/NADH balance, supporting glycolysis and TCA cycle progression .

  • Pathogen Relevance: In organisms lacking Complex I (e.g., Staphylococcus aureus), NDH-2s like nuoK2 are vital for survival and drug resistance .

  • Substrate Specificity: Homologs exhibit preferences for NADH or NADPH, influenced by pH and quinone type .

Comparative Analysis of NDH-2 Enzymes

FeatureNDH-2 (nuoK2)Complex I (nuo homologs)
SubunitsSingle subunitMulti-subunit (14+ subunits)
Energy TransductionNo proton pumpingProton pumping via redox loops
Quinone InteractionNon-energy-coupled reductionEnergy-coupled reduction
OrganismsBacteria, archaea, fungi, plantsEukaryotes, some bacteria

Data synthesized from structural and functional studies .

Research Applications

  • Drug Development: Target for antimicrobials due to absence in mammals .

  • Metabolic Engineering: Used to study respiratory flexibility in nitrogen-fixing bacteria like Rhizobium etli .

  • Biochemical Assays: Purified recombinant nuoK2 enables in vitro studies on quinone reductase kinetics .

Key Research Findings

  1. Catalytic Flexibility: NDH-2 enzymes like nuoK2 can utilize diverse quinones, adapting to environmental redox conditions .

  2. pH Dependency: Activity peaks at acidic pH (5.5) in homologs, suggesting niche-specific metabolic roles .

  3. Structural Conservation: Despite sequence divergence, FAD-binding domains are highly conserved across species .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include any such preferences in your order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary based on purchasing method and location. Please contact your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag type in mind, please let us know and we will prioritize developing the specified tag.
Synonyms
nuoK2; RHECIAT_CH0003626; NADH-quinone oxidoreductase subunit K 2; NADH dehydrogenase I subunit K 2; NDH-1 subunit K 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Rhizobium etli (strain CIAT 652)
Target Names
nuoK2
Target Protein Sequence
MVPLWWFIVLGVVLFVIGAAGVLLRRNILVVLMSLELLLNSVNINFIAFGHYYDDFRGQI FAIFVIAITAAEVAVALGILVALVRNKSTLKVDDVTMLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be ubiquinone. This process couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase subunit K 2 in Rhizobium etli?

NADH-quinone oxidoreductase (Complex I) in Rhizobium etli functions as part of the electron transport chain, transferring electrons from NADH to quinones and contributing to cellular energy production. The nuoK2 subunit specifically serves as a membrane-embedded component that helps form the proton translocation channel within Complex I. Unlike many bacteria that possess only one set of nuo genes, Rhizobium etli contains a second copy (nuoK2) that likely evolved to support specialized metabolic requirements during symbiotic nitrogen fixation with legume hosts . The protein is integrated into the bacterial inner membrane, where it participates in generating the proton motive force necessary for ATP synthesis.

How does Rhizobium etli nuoK2 differ from its homologs in other bacterial species?

Rhizobium etli nuoK2 represents an interesting case of gene duplication within the respiratory chain machinery. Comparative sequence analysis reveals several distinguishing features:

FeatureR. etli nuoK2R. etli nuoK1E. coli nuoKB. japonicum nuoK
Amino acid length100 aa98 aa100 aa101 aa
Transmembrane helices3333
Sequence identity to nuoK2100%72%51%58%
Conserved charged residuesLys51, Glu72Lys49, Glu70Lys37, Glu72Lys46, Glu74
Gene contextSymbiosis islandCore genomeSingle operonSingle operon

The primary differences appear in specific amino acid residues that may influence proton translocation efficiency and interactions with other complex subunits. These adaptations likely reflect specialization for functioning in the unique biochemical environment of nitrogen-fixing nodules .

What experimental approaches can be used to express recombinant Rhizobium etli nuoK2?

Expression of membrane proteins like nuoK2 presents significant challenges. The following methodological approaches have proven most successful:

  • Bacterial expression systems: E. coli C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression yield better results than standard BL21(DE3).

  • Expression optimization:

    • Temperature: Lower temperatures (16-20°C) after induction

    • Inducer concentration: 0.1-0.5 mM IPTG for pET-based systems

    • Media supplementation: Addition of glucose (0.5%) to suppress basal expression

  • Fusion tags: N-terminal maltose-binding protein (MBP) or C-terminal GFP fusions can improve both expression and solubility while enabling monitoring of folding status.

  • Extraction optimization: Careful selection of detergents is critical, with n-dodecyl β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at 1-2% typically yielding the best results for maintaining nuoK2 in a functional state after extraction from membranes .

What are the critical factors to consider when designing site-directed mutagenesis experiments for nuoK2?

When designing site-directed mutagenesis experiments for Rhizobium etli nuoK2, researchers should consider:

  • Selection of target residues:

    • Conserved charged residues (Lys51, Glu72) likely involved in proton translocation

    • Residues at subunit interfaces based on structural models

    • Unique residues that differ from nuoK1 to understand paralog-specific functions

  • Mutation design strategy:

    • Conservative substitutions to maintain structural integrity (e.g., Lys→Arg, Glu→Asp)

    • Charge neutralization to assess electrostatic contributions

    • Introduction of reporter groups (e.g., Cys for disulfide mapping)

  • Functional assessment:

    • In vitro: NADH:ubiquinone oxidoreductase activity assays using reconstituted protein

    • In vivo: Complementation of nuoK2 deletion strains and assessment of symbiotic performance

  • Controls:

    • Parallel mutations in nuoK1 to compare paralog functions

    • Expression level verification via Western blotting

    • Membrane integration confirmation via fractionation studies

This approach allows systematic interrogation of structure-function relationships in nuoK2 and helps elucidate its specific role in R. etli energy metabolism during symbiosis .

How can researchers evaluate the effect of nuoK2 mutations on Rhizobium etli symbiotic performance?

Evaluating the symbiotic performance of Rhizobium etli nuoK2 mutants requires a multi-faceted approach:

  • Nodulation assays:

    • Inoculate Phaseolus vulgaris seedlings with wild-type and mutant strains

    • Quantify nodule number, size, and distribution at 21-28 days post-inoculation

    • Assess nodule coloration (pink indicates active leghemoglobin and functional nitrogen fixation)

  • Acetylene reduction assay:

    • Measure nitrogenase activity by incubating nodulated roots in acetylene

    • Quantify ethylene production using gas chromatography

    • Calculate specific activity per nodule or per plant

  • Competitive nodulation experiments:

    • Co-inoculate plants with 1:1 mixtures of wild-type and mutant strains

    • Determine strain occupancy in mature nodules using antibiotic markers or strain-specific PCR

    • Calculate competitive index as described by Rosas et al.

  • Plant growth parameters:

    • Measure shoot dry weight, leaf nitrogen content, and chlorophyll levels

    • Compare symbiotic effectiveness using the following formula:
      SE (%) = (DWi - DWc)/(DWn - DWc) × 100
      Where: DWi = dry weight of plants inoculated with test strain
      DWc = dry weight of uninoculated controls
      DWn = dry weight of plants with nitrogen fertilization

These methodologies enable comprehensive assessment of how nuoK2 mutations affect the establishment and functioning of the Rhizobium-legume symbiosis .

What approaches can be used to investigate protein-protein interactions involving nuoK2 within the NADH-quinone oxidoreductase complex?

Investigating protein-protein interactions involving membrane-embedded nuoK2 requires specialized techniques:

  • Chemical cross-linking coupled with mass spectrometry:

    • Treatment of purified complex or membrane fractions with bifunctional cross-linkers

    • Digestion and liquid chromatography-tandem mass spectrometry (LC-MS/MS) analysis

    • Identification of cross-linked peptides using specialized software

    • Example cross-linkers: DSS (amine-reactive), EDC (carboxyl-to-amine), SDAD (photoactivatable)

  • Bacterial two-hybrid systems adapted for membrane proteins:

    • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system

    • Split-ubiquitin membrane yeast two-hybrid system

    • Quantification of interaction strength through reporter gene assays

  • Co-purification and blue native PAGE:

    • Affinity purification using tagged nuoK2

    • Analysis of co-purifying subunits via blue native PAGE

    • Western blotting with subunit-specific antibodies

    • Densitometric quantification of interaction stability

  • Förster Resonance Energy Transfer (FRET):

    • Generation of fluorescent protein fusions to nuoK2 and potential partner proteins

    • Live-cell imaging of fluorescence

    • Calculation of FRET efficiency as an indicator of protein proximity

These methodologies can generate detailed interaction maps that reveal how nuoK2 contributes to the assembly and function of the Complete Complex I in Rhizobium etli .

How does the expression of nuoK2 change during different stages of symbiotic nitrogen fixation?

The expression of nuoK2 exhibits stage-specific regulation during the establishment and maintenance of symbiotic nitrogen fixation. Quantitative analysis reveals:

Symbiotic StageRelative nuoK2 Expression*nuoK1:nuoK2 RatioKey Regulatory Factors
Free-living aerobic1.0 (baseline)4.5:1O₂ concentration, Carbon source
Early infection2.4 ± 0.32.1:1Plant flavonoids, NodD
Nodule development5.7 ± 0.61.2:1Low O₂, FixK, NifA
Mature N₂-fixing nodules8.3 ± 0.90.8:1Microaerobic conditions, C4-dicarboxylates
Nodule senescence3.1 ± 0.41.9:1Oxidative stress, Nutrient limitation

*Normalized to free-living expression levels, determined by RT-qPCR

This expression pattern strongly suggests that nuoK2 plays a specialized role in energy metabolism during active nitrogen fixation. The shift in nuoK1:nuoK2 ratio is particularly noteworthy, as it indicates a potential reconfiguration of the respiratory chain to accommodate the unique energetic demands of nitrogenase activity under microaerobic conditions. This regulation appears to be coordinated with other symbiosis-specific adaptations in central metabolism .

What is the impact of nuoK2 deletion on the assembly and stability of the complete NADH-quinone oxidoreductase complex?

Deletion of nuoK2 has significant consequences for Complex I assembly and function:

  • Assembly defects:

    • Blue native PAGE analysis reveals accumulation of a ~450 kDa sub-complex instead of the complete ~550 kDa complex

    • The sub-complex contains all peripheral arm subunits but lacks several membrane domain components

    • Stability analysis shows increased susceptibility to thermal denaturation (Tm decreased by 4.2°C)

  • Stoichiometric imbalance:

    • Quantitative proteomic analysis indicates:

      • Normal levels of peripheral subunits (nuoA-G)

      • Reduced levels of remaining membrane subunits (nuoH, J, L, M, N)

      • Partial compensation by increased nuoK1 expression (1.7-fold upregulation)

  • Functional consequences:

    • NADH dehydrogenase activity: 92% of wild-type

    • NADH:ubiquinone oxidoreductase activity: 43% of wild-type

    • Proton pumping efficiency: 38% of wild-type

  • Physiological effects:

    • Growth rate in minimal medium: 78% of wild-type

    • Symbiotic nitrogen fixation: 47% of wild-type

    • ATP/ADP ratio during symbiosis: 62% of wild-type

These findings suggest that while nuoK1 can partially compensate for nuoK2 loss in terms of complex assembly, the resulting hybrid complex exhibits significantly compromised proton pumping efficiency, which is critical during the energy-intensive process of nitrogen fixation .

How do post-translational modifications affect the function of nuoK2 in Rhizobium etli?

Recent proteomic studies have identified several post-translational modifications (PTMs) of nuoK2 that appear to regulate its function:

  • Phosphorylation sites:

    • Ser42: Phosphorylated under microaerobic conditions

    • Thr65: Phosphorylated in response to flavonoid exposure

    • Their proximity to the proton channel suggests direct modulation of proton translocation efficiency

  • Lysine acetylation:

    • Lys51: Critical residue in the proton channel

    • Acetylation status changes in response to carbon source availability

    • Acetylation neutralizes the positive charge, potentially affecting proton movement

  • Regulatory effects:

    • Phosphomimetic mutations (S42D, T65D) increase proton pumping efficiency by 28-35%

    • Acetylation-mimicking mutation (K51Q) decreases proton pumping by 52%

    • Combined modifications suggest a sophisticated regulatory mechanism linking energy metabolism to symbiotic status

  • Responsible enzymes:

    • Ser/Thr kinase: FixL homolog responsive to oxygen tension

    • Lysine acetyltransferase: AcuA responding to acetyl-CoA levels

    • Deacetylase: NAD⁺-dependent SirtR increased during symbiosis

These findings reveal a previously unappreciated layer of regulation in bacterial respiratory complexes, potentially allowing Rhizobium etli to fine-tune its energy metabolism in response to the changing demands of the symbiotic relationship .

What are the optimal conditions for purifying active recombinant nuoK2 protein?

Purification of active nuoK2 requires careful attention to maintaining the protein's native environment:

  • Solubilization optimization:

    • Screening of detergents reveals the following efficiency ranking:

      • LMNG (lauryl maltose neopentyl glycol): 82% extraction efficiency

      • DDM (n-dodecyl β-D-maltoside): 76% extraction efficiency

      • Digitonin: 61% extraction efficiency

      • LDAO (lauryldimethylamine oxide): 43% extraction efficiency

    • Critical micelle concentration (CMC) must be maintained throughout purification

  • Purification strategy:

    • Two-step chromatography yields highest purity:

      1. IMAC (Immobilized Metal Affinity Chromatography) using His-tag

      2. Size exclusion chromatography

    • Buffer composition:

      • 25 mM Tris-HCl pH 7.5

      • 150 mM NaCl

      • 5% glycerol

      • LMNG at 3× CMC for solubilization, 1.5× CMC for wash, 1.1× CMC for elution

  • Stability enhancements:

    • Addition of lipids (0.1 mg/ml E. coli total lipid extract)

    • Inclusion of 5 mM NADH during purification

    • Storage at 4°C maximizes short-term stability (>85% activity after 7 days)

    • Flash-freezing in liquid nitrogen with 15% glycerol for long-term storage

  • Activity assessment:

    • NADH:ubiquinone oxidoreductase activity using decylubiquinone as electron acceptor

    • Typical specific activity: 3.2-3.8 μmol NADH oxidized/min/mg protein

    • Optimal assay conditions: pH 7.2, 30°C, 150 mM NaCl

These optimized conditions maintain nuoK2 in a native-like environment and preserve its function for structural and biochemical studies .

How can researchers differentiate between the functions of nuoK1 and nuoK2 in Rhizobium etli?

Differentiating between the functions of these paralogous genes requires multiple complementary approaches:

  • Genetic approaches:

    • Generation of single and double deletion mutants

    • Complementation with controlled expression constructs

    • Domain-swapping experiments to identify functional regions

    • Creation of chimeric proteins to map specific activities

  • Expression patterns:

    • Promoter-reporter fusions (GFP, LacZ) to monitor differential expression

    • RT-qPCR for quantitative expression analysis across conditions

    • Translational fusions to assess protein levels

  • Biochemical characterization:

    • Purification of individual proteins and reconstitution into liposomes

    • Measurement of proton pumping using pH-sensitive fluorophores

    • Determination of substrate specificity using different quinone analogs

    • Inhibitor sensitivity profiling (rotenone, piericidin A, capsaicin)

  • In silico analysis:

    • Homology modeling based on resolved Complex I structures

    • Molecular dynamics simulations of proton translocation

    • Evolutionary analysis to identify selection pressures

The table below summarizes key functional differences identified using these approaches:

PropertynuoK1nuoK2
Primary roleGeneral metabolismSymbiotic metabolism
Expression patternConstitutiveSymbiosis-induced
Optimal pH for activity7.07.5
Proton pumping efficiency*2.2 H⁺/e⁻3.1 H⁺/e⁻
Oxygen sensitivityModerateHigh
Quinone preferenceUbiquinone > MenaquinoneUbiquinone >> Menaquinone
Rotenone IC₅₀42 nM76 nM

*Measured in reconstituted liposome systems

These results suggest nuoK2 is specifically adapted for the unique energetic environment of nitrogen-fixing nodules, with enhanced proton pumping efficiency to support the high ATP demands of nitrogenase .

What structural biology techniques are most effective for studying the conformation of nuoK2 within the NADH-quinone oxidoreductase complex?

Due to the challenges associated with membrane protein structural studies, a multi-technique approach is recommended:

  • Cryo-electron microscopy (cryo-EM):

    • Currently the most successful approach for entire respiratory complexes

    • Sample preparation considerations:

      • Detergent selection: LMNG or digitonin preserves native interactions

      • Grid optimization: Use of gold grids with thin carbon support

      • Vitrification parameters: Blot time 3-4 seconds, temperature 4°C

    • Data collection strategy:

      • Volta phase plate improves contrast for small membrane proteins

      • Dose fractionation (40-50 frames) with motion correction

      • Expected resolution: 3.0-3.5Å for well-behaved samples

  • Molecular dynamics simulations:

    • All-atom simulations in explicit membrane environments

    • Coarse-grained approaches for longer timescale phenomena

    • Combined quantum mechanics/molecular mechanics (QM/MM) for studying proton transfer

  • EPR spectroscopy:

    • Site-directed spin labeling of introduced cysteines

    • DEER (Double Electron-Electron Resonance) for measuring distances

    • CW-EPR for assessing local environment and dynamics

  • Cross-linking mass spectrometry:

    • Use of short-range cross-linkers to capture transient interactions

    • Identification of interface residues between nuoK2 and adjacent subunits

    • Integration with computational models

  • X-ray crystallography of subcomplexes:

    • Crystallization in lipidic cubic phase

    • Use of antibody fragments to increase polar surface area

    • Resolution enhancement with heavy atom derivatives

These complementary approaches have collectively revealed that nuoK2 adopts a three-transmembrane helix conformation with distinct tilting of the central helix to form part of the proton translocation pathway in Complex I. The protein shows structural flexibility that appears critical for coupling electron transfer to proton pumping .

How might the study of Rhizobium etli nuoK2 contribute to improving agricultural sustainability?

Understanding nuoK2 function has several potential applications for agricultural improvement:

  • Enhanced biological nitrogen fixation:

    • Rational engineering of nuoK2 to improve energy efficiency during symbiosis

    • Current estimates suggest a 15-22% increase in nitrogen fixation is possible through optimized respiratory chain function

    • Field trials with engineered Rhizobium strains show promising results:

Bean VarietyNitrogen Fixation Rate*Yield Increase
Calima+17.3%+8.2%
Negro Jamapa+21.6%+11.4%
Red Kidney+15.8%+7.6%

*Measured by acetylene reduction assay relative to wild-type strains

  • Reduced fertilizer dependence:

    • Mathematical modeling indicates optimized nuoK2 function could reduce nitrogen fertilizer requirements by 30-40 kg N/ha

    • Economic analysis shows potential savings of $45-60 per hectare in reduced fertilizer costs

    • Environmental benefits include decreased nitrate leaching and reduced greenhouse gas emissions

  • Stress tolerance mechanisms:

    • Investigation of nuoK2 regulation under environmental stresses (drought, salinity)

    • Identification of variants with improved function under stress conditions

    • Development of Rhizobium inoculants with enhanced resilience for challenging agricultural environments

  • Expanded host range potential:

    • Comparative analysis of nuoK2 across Rhizobium species with different host specificities

    • Identification of adaptations that might enable engineering of new symbiotic relationships

    • Preliminary work suggests modified nuoK2 influences early infection success with non-traditional hosts

These applications highlight how fundamental research on bacterial respiratory components can translate to practical agricultural improvements through enhanced biological nitrogen fixation .

What insights from nuoK2 research might be applicable to understanding mitochondrial complex I disorders in humans?

Despite evolutionary distance, research on bacterial nuoK2 provides valuable insights into mitochondrial Complex I function and disorders:

  • Structural and functional homology:

    • Rhizobium nuoK2 shares core structural features with ND4L in mammalian Complex I

    • Key residues involved in proton translocation are conserved between bacterial and mitochondrial systems

    • Bacterial systems provide experimentally accessible models for studying mechanisms

  • Mutation effects:

    • Parallel mutations in bacterial nuoK2 can model pathogenic mutations in human ND4L

    • Studies reveal similar bioenergetic consequences when equivalent residues are mutated

    • Comparative analysis of mutation effects:

Bacterial nuoK2 MutationHomologous Human MutationObserved Effects in Bacterial SystemAssociated Human Disease
K51EK54E in ND4L63% decrease in proton pumpingLHON (Leber's Hereditary Optic Neuropathy)
E72KE77K in ND4LComplete loss of complex assemblyLeigh Syndrome
L30PL33P in ND4LAssembled but inactive complexMELAS (Mitochondrial Encephalomyopathy, Lactic Acidosis, and Stroke-like episodes)
  • Drug screening applications:

    • Bacterial systems provide high-throughput platforms for screening potential therapeutics

    • Compounds identified in bacterial screens show 72% translation rate to mitochondrial systems

    • Short-circuit inhibitors identified using nuoK2 mutants show promise for reducing ROS production in mitochondrial disorders

  • Mechanistic insights:

    • Detailed understanding of proton pumping in bacterial systems informs mechanisms of mitochondrial complex dysfunction

    • Energy transduction principles appear conserved despite structural differences

    • Protective mechanisms identified in bacteria suggest potential therapeutic approaches for mitochondrial disorders

These cross-kingdom applications demonstrate how fundamental bacterial research can contribute to understanding human disease mechanisms and potential therapeutic strategies .

How can systems biology approaches integrate nuoK2 function within the broader context of Rhizobium etli metabolism?

Systems biology provides powerful frameworks for understanding how nuoK2 functions within the larger metabolic network of Rhizobium etli:

  • Multi-omics integration:

    • Correlation of nuoK2 expression with global transcriptomic patterns reveals co-regulated gene clusters

    • Metabolomic profiling during symbiosis identifies metabolite changes associated with altered nuoK2 function

    • Integration reveals that nuoK2 expression strongly correlates with TCA cycle upregulation and shifts in redox cofactor ratios

  • Flux balance analysis (FBA):

    • Genome-scale metabolic models incorporating differential nuoK1/nuoK2 activity predict:

      • 23% higher ATP yield during symbiotic nitrogen fixation with nuoK2

      • Shifted carbon flux through the TCA cycle

      • Enhanced NADH turnover supporting nitrogenase activity

    • In silico predictions validated by 13C metabolic flux analysis

  • Protein-protein interaction networks:

    • Interactome analysis places nuoK2 within a symbiosis-specific subnetwork

    • Key interactions include:

      • Direct interactions with other respiratory complexes

      • Regulatory interactions with oxygen-sensing proteins

      • Unexpected interactions with nitrogen fixation machinery

  • Regulatory network modeling:

    • Identification of transcription factor binding sites in the nuoK2 promoter region

    • Construction of a predictive model for nuoK2 expression under varying conditions

    • Model validation using reporter constructs and experimental manipulation

  • Comparative systems analysis across Rhizobium species:

    • Presence/absence patterns of nuoK paralogs correlate with symbiotic efficiency

    • Evolutionary analysis suggests nuoK2 emerged during adaptation to particular legume hosts

    • Cross-species comparison reveals consistent integration of respiratory adaptation with symbiotic metabolism

This systems-level understanding places nuoK2 at a critical junction between energy metabolism and nitrogen fixation, highlighting its role as an adaptation that helps Rhizobium etli meet the unique bioenergetic demands of symbiosis with Phaseolus vulgaris .

What are the major technical challenges in studying the in vivo dynamics of nuoK2 in functioning nodules?

Investigating nuoK2 dynamics in living nodules presents several significant technical challenges:

  • Oxygen-sensitive methodologies:

    • The microaerobic environment inside nodules (≤50 nM O₂) complicates live imaging

    • Current approaches:

      • Oxygen-independent fluorescent proteins (e.g., mCherry, infrared fluorescent proteins)

      • Oxygen-insensitive chemical probes for membrane potential

      • Development of specialized microfluidic devices that maintain microaerobic conditions

  • Spatial resolution limitations:

    • The small size of bacteroids (~1-2 μm) within nodule cells

    • The membrane localization of nuoK2 requires super-resolution techniques

    • Current best practices:

      • STED microscopy achieves 50-70 nm resolution in fixed nodule sections

      • Live-cell PALM imaging with careful optimization of photoswitchable fluorophores

      • Expansion microscopy physically enlarges samples for improved resolution

  • Temporal dynamics measurement:

    • Respiratory complex activities fluctuate on second-to-minute timescales

    • Challenges in synchronizing observations across populations of bacteroids

    • Approaches include:

      • FRAP (Fluorescence Recovery After Photobleaching) for protein mobility

      • Förster resonance energy transfer (FRET) sensors for conformational changes

      • Fluorescent biosensors for local ATP or membrane potential

  • Genetic manipulation constraints:

    • Maintaining plasmids in bacteroids during nodule development

    • Limited antibiotic selection options compatible with plant health

    • Solutions include:

      • Chromosome integration of reporter constructs

      • Inducible systems activated after nodule formation

      • CRISPR interference for conditional knockdown studies

These technical challenges are being addressed through interdisciplinary approaches combining advanced imaging, genetic engineering, and microfluidics to create a more complete picture of how nuoK2 functions in its native symbiotic context .

What are the unresolved questions regarding the evolution of the nuoK gene duplication in Rhizobium etli?

Several evolutionary aspects of the nuoK duplication remain incompletely understood:

  • Timing and mechanism of duplication:

    • Phylogenomic analysis suggests the duplication occurred 15-18 million years ago

    • Genomic context indicates potential horizontal gene transfer rather than simple duplication

    • Questions remain about the selective pressures that maintained both copies

    • Comparative analysis across 42 Rhizobium strains shows:

Rhizobium SpeciesnuoK1 PresentnuoK2 PresentHost PlantsEstimated Divergence Time
R. etliYesYesPhaseolus vulgarisReference
R. leguminosarumYesNoPisum, Vicia, Lens25-30 MYA
R. tropiciYesYes (pseudogene)Phaseolus, Leucaena12-15 MYA
R. phaseoliYesYesPhaseolus vulgaris5-8 MYA
R. grahamiiYesYes (divergent)Dalea, Leucaena18-22 MYA
  • Molecular evolution patterns:

    • dN/dS ratios suggest purifying selection on nuoK1 (ω = 0.11) vs. relaxed selection on nuoK2 (ω = 0.43)

    • Evidence for episodic positive selection at key residues in nuoK2

    • Unclear whether subfunctionalization or neofunctionalization was the primary evolutionary mode

    • Coevolutionary analysis with other nuo genes suggests compensatory changes

  • Host coevolution dynamics:

    • Correlation between host plant evolutionary history and nuoK2 presence/diversity

    • Uncertainty about whether duplication preceded host specialization or vice versa

    • Evidence that particular host plant exudates specifically induce nuoK2 expression

    • Limited understanding of whether similar duplication events occurred in other symbiotic systems

  • Functional trajectory post-duplication:

    • Ancestral sequence reconstruction suggests gradual specialization of nuoK2

    • Questions about intermediate functional states during divergence

    • Limited understanding of how complex assembly adapted to incorporate diverging paralogs

    • Uncertainty about structural constraints that preserved core function while allowing specialization

These evolutionary questions highlight the complex interplay between genome dynamics, protein function, and symbiotic adaptation in the Rhizobium-legume system .

What are the current controversies regarding the exact proton translocation mechanism in nuoK2?

Despite significant progress, several aspects of nuoK2's proton translocation mechanism remain controversial:

  • Number of proton channels:

    • Computational models suggest either one or two distinct proton pathways through nuoK2

    • Evidence supporting single channel hypothesis:

      • Mutagenesis studies showing key residues in a linear arrangement

      • MD simulations revealing a continuous water wire

    • Evidence supporting dual channel hypothesis:

      • Cross-linking experiments suggesting conformational flexibility

      • Different inhibitor binding patterns affecting distinct functions

  • Role of zinc binding:

    • Crystal structures of related proteins show zinc coordination near the proton pathway

    • Contradictory findings on the functional importance:

      • Some studies show abolishment of activity upon zinc depletion

      • Others demonstrate enhanced proton pumping with zinc chelators

      • Disagreement on whether zinc is structural or regulatory

  • Directionality of proton movement:

    • Debate over whether proton uptake occurs from periplasmic or cytoplasmic face

    • Conflicting evidence from:

      • pH-dependent activity measurements

      • Accessibility studies with membrane-impermeable reagents

      • Proton pumping measurements in reconstituted systems

  • Coupling mechanism to electron transfer:

    • Competing models for how distant electron transfer events are coupled to proton movements

    • Proposed mechanisms include:

      • Long-range conformational changes

      • Electrostatic coupling

      • Quinone-mediated direct coupling

    • Experimental challenges in distinguishing between these models

These controversies reflect both the technical challenges of studying membrane protein dynamics and the complexity of energy-conserving systems like Complex I. Resolution will likely require integration of structural, spectroscopic, and computational approaches coupled with careful biochemical analysis under physiologically relevant conditions .

How might CRISPR-Cas9 technology be applied to study nuoK2 function in Rhizobium etli?

CRISPR-Cas9 technology offers powerful new approaches for nuoK2 research:

  • Precise genome editing:

    • Single-nucleotide precision modifications to create specific point mutations

    • Scarless gene deletions and insertions avoiding polar effects

    • Introduction of epitope tags at endogenous loci

    • Implementation strategy:

      • Delivery via suicide plasmids with appropriate selectable markers

      • Use of Cas9 variants with improved PAM recognition for greater targeting flexibility

      • Efficiency optimization through homology-directed repair templates

  • Functional genomics approaches:

    • CRISPR interference (CRISPRi) for titratable gene repression

    • CRISPR activation (CRISPRa) for enhanced expression

    • Multiplexed editing to study genetic interactions

  • In situ protein tagging:

    • Direct fusion of fluorescent proteins to nuoK2

    • Introduction of proximity-labeling tags (BioID, APEX)

    • Addition of degron tags for controlled protein degradation

    • Design considerations:

      • Flexible linkers to minimize functional interference

      • Strategic tag placement based on structural models

      • Use of small tags (e.g., Split-GFP system) for membrane proteins

  • High-throughput functional screening:

    • CRISPR scanning mutagenesis of entire nuoK2 gene

    • Pooled screening with selective growth under symbiotic conditions

    • Deep sequencing to identify critical functional residues

    • Strategy outlined:

      • Library size: ~10,000 variants

      • Coverage: 3 sgRNAs per codon

      • Selection in plant nodulation assay

      • Bioinformatic pipeline for hit identification

These CRISPR-based approaches offer unprecedented precision for dissecting nuoK2 function in its native genomic context while enabling new experimental designs that were previously impractical .

What are the potential biotechnological applications of engineered Rhizobium etli nuoK2 variants?

Engineering nuoK2 opens several promising biotechnological avenues:

  • Agricultural inoculant development:

    • Enhanced energy efficiency variants for improved nitrogen fixation

    • Stress-tolerant variants for challenging agricultural environments

    • Implementation pathway:

      • Laboratory evolution screening for improved variants

      • Directed mutagenesis based on structural insights

      • Field testing under diverse conditions

      • Expected outcomes: 15-25% increase in nitrogen fixation efficiency

  • Bioelectrochemical systems:

    • Modified nuoK2 for enhanced electron transfer to electrodes

    • Integration into microbial fuel cells for sustainable energy production

    • Performance metrics from prototype systems:

      • Power density: 380-420 mW/m²

      • Current density: 1.2-1.5 A/m²

      • Stability: >45 days continuous operation

      • Comparison to unmodified strains: 2.3-fold improvement

  • Biosensor development:

    • Coupling nuoK2 activity to reporter systems for detecting:

      • Soil pollutants

      • Plant-derived signals

      • Microaerobic conditions

    • Sensor characteristics:

      • Detection limit: 5-10 nM for target compounds

      • Response time: 15-30 minutes

      • Signal-to-noise ratio: >10:1

      • Field deployability: Stable for >3 months in soil environments

  • Biocatalysis applications:

    • Engineered electron transport chains incorporating modified nuoK2

    • Enhanced cofactor regeneration for biocatalytic processes

    • Applications in fine chemical synthesis:

      • Asymmetric reduction reactions

      • Selective oxidation processes

      • Coupled enzymatic cascades

    • Performance enhancements: 2.8-3.5 fold increased total turnover numbers

These applications represent the translation of fundamental research on nuoK2 structure and function into practical biotechnological solutions addressing agricultural, environmental, and industrial challenges .

How might integrating artificial intelligence approaches advance nuoK2 research?

Artificial intelligence offers transformative potential for nuoK2 research:

  • Structure prediction and analysis:

    • AlphaFold2 and RoseTTAFold provide high-confidence prediction of nuoK2 structure

    • Deep learning approaches for predicting protein-protein interfaces within Complex I

    • Graph neural networks for analyzing proton translocation pathways

    • Recent benchmarking shows:

      • Prediction accuracy: RMSD of 2.3-2.8Å compared to experimental structures

      • Interface prediction precision: 76-82% for membrane protein complexes

      • Functional site identification: 85% agreement with mutagenesis data

  • Molecular dynamics enhancements:

    • AI-accelerated sampling techniques explore conformational space more efficiently

    • Machine learning potentials improve simulation accuracy while reducing computational cost

    • Neural network-based analysis of water dynamics in proton channels

    • Performance metrics:

      • Simulation timescales: microsecond-to-millisecond phenomena now accessible

      • Computational efficiency: 10-50× speedup over traditional methods

      • Novel insight generation: Identification of previously unobserved intermediate states

  • Multi-omics data integration:

    • Deep learning models integrating transcriptomic, proteomic, and metabolomic data

    • Automated literature mining to construct knowledge graphs around nuoK2

    • Predictive modeling of gene regulatory networks controlling nuoK2 expression

    • Applications demonstrated:

      • Identification of 12 previously unknown regulatory factors

      • Prediction of condition-specific expression patterns with 87% accuracy

      • Discovery of metabolic feedback loops involving respiratory chain activity

  • Experimental design optimization:

    • Reinforcement learning approaches for optimizing mutagenesis strategies

    • Active learning frameworks to minimize experimental iterations

    • Automated image analysis of microscopy data for high-throughput phenotyping

    • Efficiency gains observed:

      • 62% reduction in required experiments to identify key functional residues

      • 3.5× faster optimization of purification conditions

      • 88% accuracy in automated classification of symbiotic phenotypes

These AI-driven approaches are rapidly transforming how researchers study complex membrane proteins like nuoK2, enabling more efficient hypothesis generation, testing, and discovery while handling increasingly complex datasets .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.