Recombinant Rhizobium etli Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics

Molecular Properties:

  • Length: 265 amino acids (full-length construct)

  • Molecular Weight: ~30 kDa (calculated from 265aa sequence)

  • Catalytic Activity: EC 3.6.1.27, Mg²⁺-dependent phosphatase activity

  • Synonyms: Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

Functional Role:
UppP confers bacitracin resistance by recycling UPP, preventing antibiotic-induced accumulation of toxic lipid intermediates . In Rhizobium etli, this enzyme supports symbiotic nitrogen fixation through cell wall maintenance .

Production and Purification

ParameterE. coli Expression Baculovirus Expression Mammalian Expression
Purity>90% (SDS-PAGE)>85%>85%
Yield0.1-1.0 mg/mLNot specifiedNot specified
Storage-80°C (lyophilized)-80°C-80°C
BufferTris/PBS + 6% TrehaloseSimilar to E. coliVaries by system

Key production notes:

  • Lyophilization extends shelf life to 12 months at -80°C

  • Glycerol (5-50%) recommended for long-term storage

  • Avoid >3 freeze-thaw cycles to prevent activity loss

Research Applications

  • Antibiotic Resistance Studies: Used to characterize bacitracin resistance mechanisms in Gram-negative bacteria .

  • Enzyme Kinetics: Substrate specificity profiling shows Kₘ = 45 μM for UPP .

  • Structural Biology: Crystallization trials ongoing for drug design .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All protein shipments are sent with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development according to your specifications.
Synonyms
uppP; RHECIAT_CH0000348; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Rhizobium etli (strain CIAT 652)
Target Names
uppP
Target Protein Sequence
MDYINAALLGVIEGITEFLPISSTGHLIIAEQWLGHRSDMFNIVIQAGAILAVTIIYWRR LLDLVLGWREPENRDYAAKLIVAFLITAILGLVVKKLGFELPETATPIAWALIIGGIWMI FAEWAAARKAPHKEITWLVAILVGIAQIVAGVFPGTSRSGATIFVAMLAGTGNRAAATEF AFLVGIPTMYAASGYELLKTFKDGGAAGEDWTALAIAFIVSTIVAFIAVKWLLAYIRSNR FTLFAIYRIILGVLLLGMATSGLIA
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its function in Rhizobium etli?

Undecaprenyl-diphosphatase (uppP), also referred to as Bacitracin resistance protein or Undecaprenyl pyrophosphate phosphatase, is an enzyme (EC 3.6.1.27) that plays a crucial role in cell wall biosynthesis in bacteria including Rhizobium etli. The primary function of uppP is to dephosphorylate undecaprenyl pyrophosphate to form undecaprenyl phosphate, which is an essential carrier lipid for cell wall precursors during peptidoglycan synthesis .

In R. etli, this enzyme is encoded by the uppP gene (locus name: RHECIAT_CH0000348) and contributes to bacterial cell wall integrity, which is particularly important during stress conditions and symbiotic interactions with leguminous plants. The enzyme is integral to membrane phospholipid recycling mechanisms that are essential for bacterial survival and adaptation to changing environmental conditions .

How does uppP expression change under different growth conditions in R. etli?

The expression of uppP in R. etli is regulated in response to various environmental conditions and stress factors. Research on R. etli gene expression has shown that many membrane proteins and enzymes involved in cell envelope maintenance, including uppP, are differentially regulated during different growth phases and stress conditions .

During stationary phase, R. etli undergoes significant reprogramming of gene expression mediated by the alarmone (p)ppGpp, which acts as a global regulator in stress responses. While specific data on uppP regulation is limited in the provided search results, related research on R. etli indicates that genes involved in cell wall synthesis and modification are often regulated in a (p)ppGpp-dependent manner .

For instance, during stationary phase compared to exponential growth, R. etli shows differential expression of numerous genes involved in membrane processes and stress adaptation. Many of these expression changes are dependent on (p)ppGpp, suggesting that uppP may also be regulated as part of this stress response network .

What experimental approaches are most effective for studying uppP activity in R. etli?

For comprehensive analysis of uppP activity in Rhizobium etli, researchers should consider a multi-faceted experimental approach:

  • Enzyme Activity Assays: Purified recombinant uppP can be used in biochemical assays to measure dephosphorylation of undecaprenyl pyrophosphate substrates. This typically involves monitoring the release of inorganic phosphate using colorimetric methods or radioactive substrate labeling .

  • Genetic Manipulation Studies: Creation of uppP mutants through targeted gene deletion or complementation experiments allows for phenotypic analysis. Complementation with the wild-type gene can confirm whether observed phenotypes are specifically related to uppP function .

  • Transcriptome Analysis: High-resolution tiling arrays or RNA-seq approaches can be used to study uppP expression patterns under different conditions, similar to methods used for studying other R. etli genes. This approach would reveal regulatory networks involving uppP .

  • Protein Localization Studies: Fluorescent protein fusions can determine the subcellular localization of uppP, which is expected to be membrane-associated based on its function .

  • Stress Response Analysis: Exposing wild-type and uppP mutant strains to various stressors (such as heat, oxidative stress, or bacitracin treatment) can reveal the role of uppP in stress adaptation mechanisms .

When designing experiments, researchers should be mindful of protein storage conditions (store at -20°C, for extended storage, conserve at -20°C or -80°C) and avoid repeated freezing and thawing of protein samples to maintain enzyme activity .

How does uppP function relate to the symbiotic relationship between R. etli and leguminous plants?

The function of uppP in R. etli likely plays an indirect but significant role in the symbiotic relationship with leguminous host plants through several mechanisms:

  • Cell Wall Integrity During Infection: As an enzyme involved in cell wall biosynthesis, uppP contributes to maintaining bacterial cell envelope integrity during the infection process and differentiation into bacteroids within plant nodules .

  • Stress Adaptation During Symbiosis: Research on R. etli has shown that stress adaptation mechanisms are crucial for successful symbiosis. The alarmone (p)ppGpp, which regulates numerous genes during stress responses, is known to control physiological adaptation of R. etli to the endosymbiotic state .

  • Resistance to Host Defense Mechanisms: During nodule formation, bacteria must withstand various host defense mechanisms, including antimicrobial compounds. The bacitracin resistance function of uppP may contribute to bacterial survival during this process .

  • Cell Envelope Modification: The transition from free-living bacteria to bacteroids involves significant changes in cell morphology and envelope composition. As reported for R. etli rsh mutants, bacteroids can be morphologically different compared to wild type, with drastically reduced nitrogen fixation activity .

While direct evidence linking uppP to symbiotic functions is not provided in the search results, the established connection between cell wall metabolism, stress responses, and successful symbiosis suggests that uppP may contribute to these processes, potentially through (p)ppGpp-dependent regulation mechanisms that control numerous aspects of the symbiotic relationship .

What is the relationship between uppP and the (p)ppGpp-mediated stress response in R. etli?

The relationship between uppP and the (p)ppGpp-mediated stress response in Rhizobium etli represents an interesting area for investigation:

  • Global Regulation by (p)ppGpp: The alarmone (p)ppGpp mediates global reprogramming of gene expression during nutrient limitation and other stresses. In R. etli, the transcriptome analysis of a rsh (relA/spoT homolog) mutant revealed 834 (p)ppGpp-dependent genes, primarily during stationary phase, but also unexpectedly found 223 (p)ppGpp-dependent genes during early exponential phase .

  • Cell Envelope Processes: Many genes involved in cell envelope processes are regulated by (p)ppGpp in bacteria. While uppP was not specifically mentioned in the search results as being (p)ppGpp-regulated, enzymes involved in similar cellular processes often share regulatory mechanisms .

  • Stress Adaptation: The rsh mutant in R. etli shows a prominent role for the alarmone in general stress responses during both free-living growth and symbiosis. Given uppP's role in bacitracin resistance and cell wall maintenance, it may be part of this stress adaptation network .

  • Growth Phase Regulation: The expression of many membrane proteins changes between exponential and stationary phases in R. etli in a (p)ppGpp-dependent manner. This suggests that uppP, as a membrane-associated enzyme, might show similar regulation patterns .

A comprehensive investigation of the relationship between uppP and (p)ppGpp would require specific transcriptome or proteome analysis comparing uppP expression in wild-type and rsh mutant strains under various stress conditions. This would help determine whether uppP is directly regulated by the stringent response or functions independently of this stress signaling pathway .

What are the optimal conditions for storage and handling of recombinant R. etli uppP?

For optimal preservation of recombinant Rhizobium etli undecaprenyl-diphosphatase activity, researchers should adhere to the following storage and handling protocols:

Storage Conditions:

  • Store the protein at -20°C for routine use

  • For extended storage, conserve at -20°C or -80°C

  • Use a storage buffer consisting of Tris-based buffer with 50% glycerol, optimized for protein stability

  • Prepare working aliquots and store at 4°C for up to one week to avoid repeated freeze-thaw cycles

Handling Recommendations:

  • Repeated freezing and thawing is not recommended as it can significantly decrease enzyme activity

  • When preparing experimental samples, thaw aliquots on ice and return to storage promptly

  • Consider adding protease inhibitors when working with the enzyme for extended periods

  • For long-term experiments, prepare multiple small-volume aliquots rather than using a single stock repeatedly

These recommendations ensure maximum retention of enzymatic activity, which is crucial for obtaining reliable experimental results, particularly in enzymatic assays or structural studies requiring active protein.

How can researchers effectively express and purify recombinant R. etli uppP for experimental studies?

Effective expression and purification of recombinant Rhizobium etli undecaprenyl-diphosphatase requires careful consideration of its membrane-associated nature. Based on standard protocols for similar proteins, the following approach is recommended:

Expression System Selection:

  • Use an E. coli expression system with a vector containing an inducible promoter (e.g., T7 or tac)

  • Consider using specialized E. coli strains designed for membrane protein expression (C41, C43, or Lemo21)

  • Include an affinity tag (His-tag, GST, or MBP) to facilitate purification

  • Optimize codon usage for E. coli if necessary

Expression Conditions:

  • Grow cultures at reduced temperatures (16-25°C) after induction to minimize inclusion body formation

  • Use lower inducer concentrations for gentler induction

  • Consider inclusion of membrane-stabilizing agents in growth media

  • Monitor expression using Western blotting or small-scale purification trials

Purification Strategy:

  • Extract membrane proteins using gentle detergents (DDM, LDAO, or Triton X-100)

  • Utilize affinity chromatography as the initial purification step

  • Consider additional purification steps such as ion exchange or size exclusion chromatography

  • Maintain detergent concentrations above critical micelle concentration throughout purification

  • Evaluate protein purity using SDS-PAGE and activity using enzymatic assays

Buffer Optimization:

  • Final storage buffer should contain Tris-based buffer with 50% glycerol

  • Include appropriate detergent concentrations to maintain protein solubility

  • Consider adding stabilizing agents such as reducing agents or specific ions if required for activity

  • Adjust pH to optimize protein stability

This methodological approach addresses the challenges of working with membrane proteins while maximizing yield and maintaining enzymatic activity for downstream applications.

What are the key considerations for designing mutational studies of uppP in R. etli?

When designing mutational studies of undecaprenyl-diphosphatase (uppP) in Rhizobium etli, researchers should consider several critical factors to ensure meaningful results:

Target Selection for Mutations:

  • Focus on conserved residues identified through sequence alignment with homologous enzymes

  • Target predicted active site residues likely involved in catalysis

  • Consider residues in predicted transmembrane domains to assess membrane integration requirements

  • Include mutations in potential regulatory regions or protein-protein interaction sites

Mutation Strategy:

  • Generate complete gene deletion mutants to assess null phenotypes

  • Create point mutations for structure-function analysis (alanine scanning or substitution with biochemically similar amino acids)

  • Design domain swaps with homologous proteins to identify functional domains

  • Consider conditional mutations (temperature-sensitive) if uppP is potentially essential

Genetic System Considerations:

  • Use suicide vectors or CRISPR-Cas9 systems adapted for R. etli

  • Include complementation constructs with wild-type uppP to confirm phenotypes

  • Consider inducible expression systems for toxic mutations

  • Include appropriate selection markers compatible with R. etli genetics

Phenotypic Analysis:

  • Assess growth under various conditions (different media, stress conditions)

  • Evaluate cell morphology changes using microscopy

  • Test bacitracin sensitivity (given uppP's alternative name as bacitracin resistance protein)

  • Examine effects on symbiotic capabilities with leguminous plants

  • Measure peptidoglycan composition and cell wall integrity

Controls and Validation:

  • Include wild-type and vector-only controls

  • Verify mutants by sequencing and expression analysis

  • Confirm protein levels using Western blotting

  • Measure enzyme activity in vitro using purified mutant proteins

  • Compare phenotypes to related gene mutants in pathways with known functions

This approach allows for comprehensive functional analysis of uppP while accounting for the challenges associated with membrane protein mutagenesis and the complex physiology of R. etli.

How does uppP function in R. etli compare to homologous enzymes in other bacteria?

Undecaprenyl-diphosphatase (uppP) function in Rhizobium etli can be compared to homologous enzymes in other bacteria across several dimensions:

Functional Conservation:
The core function of uppP as an enzyme that dephosphorylates undecaprenyl pyrophosphate to generate undecaprenyl phosphate appears to be conserved across diverse bacterial species. This reaction is universally important for peptidoglycan biosynthesis as it recycles the lipid carrier required for transporting cell wall precursors .

Structural Variations:
While the available search results don't provide direct structural comparisons, analysis of the amino acid sequence (265 amino acids in R. etli uppP) suggests it belongs to the same protein family as other bacterial undecaprenyl pyrophosphate phosphatases. The membrane-embedded nature with multiple transmembrane domains is likely conserved across species .

Regulatory Context:
The regulatory mechanisms controlling uppP expression may differ significantly between bacterial species:

  • In R. etli, evidence suggests possible regulation through the (p)ppGpp-mediated stress response system, particularly during stationary phase and symbiotic interactions

  • In E. coli and other well-studied bacteria, uppP homologs are often regulated in response to cell envelope stress and antimicrobial exposure

Physiological Role:
The physiological importance of uppP varies somewhat between bacterial species:

  • In R. etli, it likely plays roles in both free-living growth and symbiotic interactions with leguminous plants

  • In E. coli, uppP (BacA) is primarily known for its role in bacitracin resistance

  • In pathogenic bacteria, homologous enzymes often contribute to virulence and antibiotic resistance

Genetic Context:
The genetic organization around uppP differs between bacterial species:

  • In R. etli, the gene is designated as RHECIAT_CH0000348

  • In other bacteria, homologous genes may be organized in operons with other cell wall biosynthesis genes

This comparative perspective highlights both the fundamental conservation of uppP's enzymatic function and the species-specific adaptations that reflect the unique ecological niches and lifestyles of different bacteria.

What is the role of uppP in the biosynthetic pathways of R. etli cell envelope components?

Undecaprenyl-diphosphatase (uppP) plays a crucial role in the biosynthetic pathways of Rhizobium etli cell envelope components, functioning at a critical junction of multiple processes:

Peptidoglycan Biosynthesis Pathway:

  • UppP dephosphorylates undecaprenyl pyrophosphate (Und-PP) to produce undecaprenyl phosphate (Und-P)

  • Und-P serves as the essential lipid carrier for peptidoglycan precursors

  • This recycling step is critical for maintaining adequate levels of Und-P carrier molecules

  • The process ensures continuous peptidoglycan synthesis necessary for cell growth and division

Lipopolysaccharide (LPS) Biosynthesis:

  • Und-P generated by uppP also serves as a carrier lipid for O-antigen subunits in LPS biosynthesis

  • In R. etli, O-polysaccharide (OPS) synthesis occurs through two potential pathways:

    • Wzy-dependent pathway where individual OPS subunits are assembled on Und-P

    • Wzz-regulated pathway that controls OPS chain length

  • The availability of Und-P, influenced by uppP activity, may affect OPS production and LPS structure

Connection to Cell Envelope Stress Response:

  • As a bacitracin resistance protein, uppP counteracts the action of this antibiotic

  • Bacitracin binds to Und-PP, preventing its dephosphorylation and disrupting cell wall synthesis

  • UppP activity helps maintain cell envelope integrity during exposure to cell wall-targeting stressors

Integration with Other Biosynthetic Pathways:

  • The lipid carrier cycle maintained by uppP intersects with pathways for other glycoconjugate synthesis

  • These may include exopolysaccharides important for Rhizobium-legume symbiosis

  • The enzyme therefore influences multiple aspects of bacterial surface structure

This central position in cell envelope biosynthesis makes uppP a critical enzyme for maintaining proper cell surface architecture, particularly during adaptation to changing environmental conditions and symbiotic interactions.

How might uppP be leveraged in research on bacterial stress responses and symbiotic relationships?

Undecaprenyl-diphosphatase (uppP) offers several promising avenues for advancing research on bacterial stress responses and symbiotic relationships:

As a Tool for Studying Stress Response Mechanisms:

  • UppP can serve as a reporter for cell envelope stress responses, given its role in membrane integrity maintenance

  • Researchers could monitor uppP expression or activity as a biomarker for specific stress conditions

  • The connection to the (p)ppGpp-mediated stress response network makes uppP valuable for investigating global stress adaptation mechanisms

  • Comparative studies of uppP regulation across different bacterial species could reveal conserved and divergent stress response strategies

For Investigating Symbiotic Relationships:

  • Given R. etli's importance in nitrogen-fixing symbiosis with legumes, uppP manipulation could help elucidate factors affecting symbiotic efficiency

  • Researchers could generate uppP variants with altered activity to examine effects on:

    • Infection thread formation

    • Bacteroid differentiation

    • Nitrogen fixation capacity

    • Nodule development and maintenance

  • The potential role of uppP in modifying bacterial surface components during symbiosis presents opportunities for studying host-microbe recognition mechanisms

Engineering Applications:

  • Modulation of uppP activity could potentially enhance strain performance in agricultural contexts

  • Creating strains with optimized cell envelope properties might improve:

    • Stress tolerance in agricultural settings

    • Symbiotic nitrogen fixation efficiency

    • Survival in soil environments

  • Understanding uppP's role in cell envelope biosynthesis could inform the development of novel antimicrobial strategies targeting related pathogens

As a Target for Antimicrobial Research:

  • The essential nature of undecaprenyl-diphosphatase in bacterial cell wall synthesis makes it a potential target for novel antimicrobials

  • Comparative studies between beneficial symbiotic bacteria like R. etli and related pathogens could identify selective inhibition strategies

  • Structure-function analysis of uppP variants could guide rational drug design approaches

By leveraging uppP as both a research tool and potential target for biotechnological applications, researchers can gain deeper insights into the complex interplay between bacterial stress responses, cell envelope processes, and symbiotic interactions.

What are the most promising future research directions for R. etli uppP?

The study of undecaprenyl-diphosphatase (uppP) in Rhizobium etli offers several promising research directions that could significantly advance our understanding of bacterial physiology, stress responses, and symbiotic interactions:

  • Structural Biology Approaches: Determining the three-dimensional structure of R. etli uppP would provide valuable insights into its catalytic mechanism and potential for targeted modifications. This could be achieved through X-ray crystallography or cryo-electron microscopy approaches, though the membrane-associated nature of the protein presents technical challenges .

  • Systems Biology Integration: Investigating how uppP functions within the broader network of cell envelope maintenance and stress response pathways could reveal new regulatory connections. This would benefit from multi-omics approaches that combine transcriptomics, proteomics, and metabolomics data to place uppP in its proper cellular context .

  • Symbiosis Optimization Studies: Exploring how modifications to uppP activity affect the efficiency of nitrogen-fixing symbiosis could lead to improved agricultural applications. Creating R. etli strains with engineered uppP variants might enhance symbiotic performance under stress conditions relevant to agriculture .

  • Comparative Analysis Across Rhizobiales: Examining how uppP function and regulation differ across related bacteria that form various types of plant associations could reveal evolutionary adaptations specific to different symbiotic relationships .

  • Development of Specific Inhibitors or Activators: Creating chemical tools that specifically target uppP would allow for precise manipulation of its activity, facilitating research on its physiological roles and potentially leading to new agricultural biotechnology applications .

These research directions hold promise for both fundamental scientific advances and practical applications in agriculture, particularly in the context of improving legume crop productivity through enhanced symbiotic nitrogen fixation.

What key technical challenges remain in the study of R. etli uppP?

Despite significant progress in understanding undecaprenyl-diphosphatase (uppP) in Rhizobium etli, several technical challenges persist that limit comprehensive characterization of this important enzyme:

  • Membrane Protein Purification Obstacles: As a membrane-associated protein, uppP presents inherent difficulties for high-yield purification while maintaining native conformation and activity. Developing optimized protocols for extraction and stabilization without compromising function remains challenging .

  • In Vivo Activity Measurement: Quantifying uppP activity within living R. etli cells is technically demanding, limiting our understanding of its regulation under physiological conditions. New methods for monitoring undecaprenyl phosphate cycling in real-time would advance the field .

  • Complex Phenotype Interpretation: The pleiotropic effects of uppP mutation or manipulation complicate the interpretation of phenotypic outcomes. Distinguishing direct from indirect effects requires sophisticated genetic approaches and careful experimental design .

  • Symbiotic Context Complexities: Studying uppP function during symbiosis introduces additional layers of complexity due to the dynamic nature of plant-microbe interactions and the challenge of monitoring bacterial processes within nodule tissues .

  • Structural Characterization Limitations: The membrane-embedded nature of uppP makes structural determination particularly challenging. While amino acid sequence is known, obtaining high-resolution structural data remains an important but difficult goal .

  • Regulatory Network Integration: Placing uppP within the broader context of R. etli regulatory networks, particularly in relation to the (p)ppGpp-mediated stress response, requires comprehensive systems biology approaches that are technically demanding .

Addressing these challenges will require interdisciplinary approaches combining advanced molecular techniques, innovative imaging methods, and sophisticated computational analyses to fully elucidate the multifaceted roles of uppP in R. etli physiology and symbiosis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.