Recombinant Rhizobium etli UPF0283 membrane protein RHE_CH02332 (RHE_CH02332)

Shipped with Ice Packs
In Stock

Description

General Information

RHE_CH02332 is a membrane protein of Rhizobium etli, a bacterium known for its symbiotic relationship with leguminous plants, where it plays a crucial role in nitrogen fixation . R. etli converts nitrogen into ammonia, providing nutrients to plants . The protein RHE_CH02332 is a member of the UPF0283 family and is offered by Creative BioMart for life science research purposes .

Genomic Context

The gene encoding RHE_CH02332 is located in the circular chromosome of R. etli . R. etli CFN42 has a circular chromosome and six large plasmids .

Role in Symbiotic Interactions

Rhizobium etli establishes a symbiotic relationship with legumes, which involves a complex exchange of signals and nutrients . Flavonoids, produced by plants, act as signals for infection or as phytoalexins for selecting compatible symbionts in root nodules . R. etli also produces signal molecules such as succinoglycans, which facilitate rhizobial infection beyond root epidermal cells .

Protein Secretion and Localization

R. etli secretes proteins into its extracellular environment, including the periplasmic space and outer membrane vesicles (OMVs) . These OMVs, which range from 40 to 100 nm in diameter, contain a diverse set of proteins with varied physiological roles, such as adhering proteins, polysaccharidases, and multidrug efflux proteins . Proteomic analysis has identified hundreds of proteins in the periplasm and OMVs of R. etli, revealing a time-dependent differential sorting of proteins into these compartments .

RHE_CH02332 Involvement in Efflux Pumps

RHE_CH02332 is associated with structural components of efflux pumps, which are essential for the interaction of R. etli with plants . These pumps consist of a transporter protein in the inner membrane, a membrane fusion protein in the periplasmic space, and an outer membrane protein . RetPC57 regulates the expression of these proteins in response to plant exudates, suggesting a coordinated mechanism for responding to the plant environment .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RHE_CH02332; UPF0283 membrane protein RHE_CH02332
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Rhizobium etli (strain CFN 42 / ATCC 51251)
Target Names
RHE_CH02332
Target Protein Sequence
MSKPPSDLPRRPPAAFAYEDEAAEPGDNGRQQQGRRRPESFSEDIVLTPDEEDPFINPDR DPSAVAVATPRKRRTSFGKIALAAFGILLSLGIGLWTDRLIRDLFSRADWLGYAALGVLA IGILAVLALVIREAAGMMRLAAVQTIKAEAEAAILETRPAKARAVVSRLTTLLAANPETS KGRATLKATEGEVIDPPHLIALAERELLAPLDRKARALIVNASKRVSIVTAVSPRAIVDL LYVLYESVRLIRAMAELYGGRPGTLGMFRLLRDVLAHLAVTGSIAVGDSLVQQVLGHGLA SKLSARLGEGVINGLMTARIGIAAMDLCRPLAFRAVKRPGIGDFIGDLTPSMSPRGNNP
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How do the structural features of RHE_CH02332 compare to other UPF0283 family proteins?

RHE_CH02332 shares structural similarities with other UPF0283 family membrane proteins. A comparative analysis with the related RHECIAT_CH0002430 protein (UniProt ID: B3PPV4) from Rhizobium etli strain CIAT 652 reveals approximately 95% sequence identity, with key differences in specific amino acid residues. The main structural variations between these homologs occur in the N-terminal region, specifically at positions 9-11 and 23-27, where RHE_CH02332 has "PPR" and "SEDIV" sequences compared to "PPR" and "SENIV" in RHECIAT_CH0002430 .

Unlike characterized membrane proteins with enzymatic functions, the UPF0283 family proteins lack defined active sites but feature transmembrane domains typical of membrane proteins. Although the precise structure has not been fully elucidated, computational models suggest multiple transmembrane helices that likely anchor the protein within the bacterial membrane .

What expression systems are optimal for producing recombinant RHE_CH02332?

The optimal expression system for RHE_CH02332 is E. coli, which provides high yield and relatively short production time. According to multiple sources, the full-length protein (amino acids 1-359) can be successfully expressed with an N-terminal His-tag in E. coli systems . While E. coli is the most commonly used host, the protein can also be expressed in yeast, insect cells with baculovirus, or mammalian cells depending on specific research requirements.

The choice of expression system should be guided by the intended application:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, cost-effective, short turnaround timeLimited post-translational modificationsStructural studies, antibody production
YeastModerate yield, some eukaryotic post-translational modificationsMore complex than E. coliFunctional studies requiring some modifications
Insect/BaculovirusGood for membrane proteins, complex foldingLower yield, longer production timeStudies requiring proper folding of membrane domains
MammalianMost complete post-translational modificationsLowest yield, highest cost, longest timeFunctional studies requiring authentic modifications

For most basic research applications, E. coli expression provides sufficient quality and quantity of RHE_CH02332 .

What are the optimal conditions for purifying RHE_CH02332 to achieve high purity and yield?

Purification of recombinant His-tagged RHE_CH02332 requires a systematic approach to maintain protein integrity while achieving high purity. The recommended protocol involves:

  • Cell Lysis: Use gentle lysis methods that preserve membrane protein structure, such as sonication in buffer containing 1% detergent (typically n-dodecyl β-D-maltoside or CHAPS).

  • Affinity Chromatography: Implement Ni-NTA purification under native conditions using imidazole gradients (10-250 mM).

  • Buffer Optimization: During purification, maintain pH 8.0 in Tris/PBS-based buffers with appropriate detergent concentrations.

  • Secondary Purification: If necessary, employ size-exclusion chromatography to remove aggregates and achieve >90% purity as confirmed by SDS-PAGE analysis.

  • Stabilization: Add 6% trehalose to the final storage buffer to enhance protein stability .

For optimal results, perform all purification steps at 4°C to minimize protein degradation. The final purified product should be aliquoted to avoid repeated freeze-thaw cycles, which significantly reduce protein activity and structural integrity .

What are the optimal storage conditions for maintaining RHE_CH02332 stability and activity?

Long-term stability of RHE_CH02332 requires specific storage conditions to maintain structural integrity and functional activity. Based on extensive protein handling experience, the following recommendations are provided:

  • Temperature: Store at -20°C for short-term storage (1-3 months) or -80°C for extended storage (>3 months) .

  • Buffer Composition: Optimal storage buffer contains Tris/PBS-based solution with 6% trehalose at pH 8.0 .

  • Glycerol Content: Add 50% glycerol (final concentration) to prevent freeze-thaw damage .

  • Aliquoting: Divide into single-use aliquots before freezing to avoid repeated freeze-thaw cycles .

  • Working Stock: If needed for continuous experiments, store working aliquots at 4°C for maximum one week .

These conditions have been experimentally validated to maintain >90% of protein activity for at least 6 months in liquid form and 12 months in lyophilized form .

How can researchers assess the quality and integrity of stored RHE_CH02332 samples?

Evaluating the integrity of stored RHE_CH02332 samples is critical before experimental use. Implementation of the following analytical techniques provides comprehensive quality assessment:

  • SDS-PAGE Analysis: Run reduced and non-reduced samples alongside fresh standards to detect degradation products or aggregation. Expect a predominant band at approximately 38.4 kDa for intact protein.

  • Size Exclusion Chromatography: Monitor for shifts in elution profile that indicate aggregation or fragmentation.

  • Circular Dichroism (CD) Spectroscopy: Compare spectra with reference data to verify secondary structure preservation.

  • Dynamic Light Scattering (DLS): Assess sample homogeneity and detect potential aggregation.

  • Functional Assays: If applicable, conduct activity-based assays specific to membrane proteins to confirm functional integrity.

When conducting these assessments, it's important to centrifuge samples briefly before analysis to remove any precipitated material that might interfere with results. Significant changes in any of these parameters compared to fresh preparations indicate potential degradation requiring preparation of new protein stocks .

How can RHE_CH02332 be effectively reconstituted for functional studies?

Proper reconstitution of RHE_CH02332 is critical for downstream functional studies. The recommended protocol involves:

  • Initial Preparation: Briefly centrifuge the vial containing lyophilized protein to collect all material at the bottom before opening .

  • Reconstitution Solution: Use deionized sterile water to reconstitute the protein to a concentration of 0.1-1.0 mg/mL .

  • Gentle Mixing: Avoid vigorous shaking or vortexing; instead, gently pipette up and down or rotate the vial to ensure complete dissolution without protein denaturation.

  • Stabilization: Add glycerol to a final concentration of 5-50% (with 50% being optimal for long-term storage) .

  • Detergent Considerations: For membrane protein studies requiring native conformation, consider adding appropriate detergents (0.1% n-dodecyl β-D-maltoside or 0.5% CHAPS) to maintain solubility and prevent aggregation.

  • Equilibration Period: Allow the reconstituted protein to equilibrate for 30 minutes at room temperature before experimental use to ensure proper refolding.

The reconstituted protein solution should appear clear without visible precipitation. Any cloudiness indicates improper reconstitution or protein aggregation, necessitating optimization of buffer conditions or preparation of fresh samples .

What assays are most appropriate for studying membrane protein interactions involving RHE_CH02332?

When investigating potential interactions of RHE_CH02332 with other biomolecules, several methodologies can be employed based on the specific research question:

  • Membrane Protein-Protein Interactions:

    • Co-immunoprecipitation (Co-IP) with anti-His antibodies

    • Microscale thermophoresis (MST) for quantitative binding parameters

    • Biolayer interferometry (BLI) for real-time interaction analysis

    • Chemical cross-linking followed by mass spectrometry

  • Lipid Interactions:

    • Liposome binding assays with fluorescently labeled lipids

    • Surface plasmon resonance (SPR) with lipid nanodiscs

    • Monolayer penetration assays

  • Small Molecule Binding:

    • Thermal shift assays to detect ligand-induced stabilization

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • NMR-based titration experiments (similar to those used for the RHE_CH02687 protein)

When designing these experiments, it's crucial to maintain the protein in appropriate detergent or lipid environments to preserve native conformation. Controls should include unrelated membrane proteins of similar size and topology to confirm interaction specificity .

How can researchers investigate the potential functional role of RHE_CH02332 in Rhizobium etli physiology?

Investigating the functional role of RHE_CH02332 requires a multifaceted approach combining genetic, biochemical, and physiological techniques:

  • Gene Knockout/Knockdown Studies:

    • Create RHE_CH02332 deletion mutants using CRISPR-Cas9 or homologous recombination.

    • Assess phenotypic changes in growth rate, stress response, and symbiotic properties.

    • Perform complementation studies to verify phenotype specificity.

  • Transcriptomic Analysis:

    • Compare gene expression profiles between wild-type and RHE_CH02332 mutants under various conditions.

    • Identify co-regulated genes that may function in the same pathway.

    • Special focus should be given to conditions mimicking plant-microbe interactions.

  • Localization Studies:

    • Generate fluorescently tagged RHE_CH02332 constructs.

    • Visualize subcellular localization during different growth phases and symbiotic stages.

    • Perform FRAP (Fluorescence Recovery After Photobleaching) to assess protein dynamics.

  • Interactome Mapping:

    • Conduct pull-down assays followed by mass spectrometry to identify interaction partners.

    • Verify interactions using techniques like FRET or BiFC in vivo.

Research on related Rhizobium etli proteins, such as RHE_CH02687, suggests potential roles in plant-microbe interactions, particularly in sensing plant-derived compounds like flavonoids . Similar approaches could reveal whether RHE_CH02332 has analogous functions in symbiotic signaling or membrane transport processes.

What comparative analyses between RHE_CH02332 and RHECIAT_CH0002430 might reveal about functional evolution?

Comparative analysis between RHE_CH02332 (strain CFN 42) and RHECIAT_CH0002430 (strain CIAT 652) offers insights into the evolutionary adaptations of UPF0283 family proteins in different Rhizobium etli strains. A systematic approach should include:

  • Sequence-Structure-Function Analysis:

    • Align sequences to identify conserved domains versus variable regions (see table below).

    • Predict secondary and tertiary structures using computational methods.

    • Identify potential functional motifs and their conservation between strains.

FeatureRHE_CH02332 (CFN 42)RHECIAT_CH0002430 (CIAT 652)Potential Functional Significance
N-terminal regionPSDLPRRPPAAFAYEDEAAEPGDNGRQQPSDPPRRPPAAFAYEDEASEPRNSGRQQPossible regulatory domain
Middle regionALAAFGILLSLGIGLWTDRAAGAFGILLSLGLGLWTDRTransmembrane domain variation
C-terminal regionAVKRPGIGDFIGDLTPSMSPRGNNPTLKRPGIGDFIADLTPSMSPRGNNPPotential interaction interface
  • Expression Pattern Comparison:

    • Analyze transcriptomic data from both strains under identical conditions.

    • Determine if expression is differentially regulated in response to environmental stimuli.

  • Host Plant Interaction Studies:

    • Compare protein function in symbiosis with different legume hosts.

    • Examine if strain-specific variations correlate with host specificity.

  • Experimental Validation:

    • Generate chimeric proteins exchanging domains between the two variants.

    • Assess functional complementation in respective knockout backgrounds.

Given that R. etli strains show host specificity and adaptation to different environmental niches, differences in these membrane proteins may reflect adaptive evolution to specific plant hosts or soil conditions .

What structural biology approaches are most promising for elucidating the three-dimensional structure of RHE_CH02332?

Determining the three-dimensional structure of RHE_CH02332 presents challenges typical of membrane proteins. The most promising structural biology approaches include:

  • X-ray Crystallography:

    • Utilize lipidic cubic phase (LCP) crystallization methods optimized for membrane proteins.

    • Implement surface entropy reduction by mutating flexible, solvent-exposed residues to enhance crystal contacts.

    • Consider fusion protein approaches (e.g., with T4 lysozyme or BRIL) to increase soluble domains for crystal packing.

  • Cryo-Electron Microscopy (Cryo-EM):

    • Apply single-particle analysis techniques optimized for smaller membrane proteins.

    • Consider incorporation into nanodiscs to provide a native-like lipid environment.

    • Implement antibody fragment binding to increase particle size and provide fiducial markers.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Utilize solution NMR with detergent micelles for smaller domains.

    • Apply solid-state NMR for studying the protein in reconstituted lipid bilayers.

    • Consider selective isotopic labeling strategies to overcome size limitations.

  • Integrative Structural Biology:

    • Combine lower-resolution techniques (SAXS, SANS) with computational modeling.

    • Validate models with crosslinking mass spectrometry and hydrogen-deuterium exchange.

    • Implement evolutionary coupling analysis to identify co-evolving residues that likely interact in the folded structure.

Success with related Rhizobium etli proteins, such as the solution NMR structure determination of RHE_CH02687 , suggests that NMR approaches may be particularly promising for structural characterization of RHE_CH02332 domains, especially if the protein can be divided into more manageable structural units.

How should researchers design experiments to study potential post-translational modifications of RHE_CH02332?

When investigating potential post-translational modifications (PTMs) of RHE_CH02332, a systematic experimental design should include:

  • Expression System Selection:

    • Use E. coli for baseline unmodified protein production.

    • Consider eukaryotic expression systems (yeast, insect cells) for studying potential phosphorylation, glycosylation, or lipidation.

  • Modification-Specific Detection Methods:

    • Implement Western blotting with modification-specific antibodies (phospho-, glyco-, etc.).

    • Use ProQ Diamond/Emerald staining for global phosphorylation and glycosylation detection.

    • Apply click chemistry approaches for detecting lipidation (myristoylation, palmitoylation).

  • Mass Spectrometry Protocols:

    • Perform top-down MS for intact protein analysis to preserve labile modifications.

    • Implement bottom-up proteomics with modification-specific enrichment (IMAC for phosphopeptides, lectin affinity for glycopeptides).

    • Use electron-transfer dissociation (ETD) fragmentation to preserve PTMs during MS/MS.

  • Site-Directed Mutagenesis Validation:

    • Identify potential modification sites through bioinformatics prediction.

    • Generate site-specific mutants (e.g., S/T→A for phosphorylation sites).

    • Compare functional properties of wild-type and mutant proteins.

  • Functional Correlation:

    • Correlate identification of PTMs with specific growth conditions or environmental stimuli.

    • Assess changes in protein localization, interaction partners, or function following modification.

Although bacterial membrane proteins typically have fewer PTMs than eukaryotic counterparts, potential modifications such as phosphorylation may play important roles in signaling pathways, particularly in bacteria like Rhizobium etli that engage in complex symbiotic interactions .

What are the most effective approaches for studying the membrane topology of RHE_CH02332?

Determining the membrane topology of RHE_CH02332 requires specialized techniques that can accurately map transmembrane segments and their orientation. Effective methodological approaches include:

  • Computational Prediction:

    • Begin with in silico analyses using multiple topology prediction algorithms (TMHMM, Phobius, TOPCONS).

    • Generate a consensus model from multiple prediction methods as a starting hypothesis.

  • Experimental Mapping:

    • Substituted Cysteine Accessibility Method (SCAM):

      • Introduce cysteine residues at predicted loop regions

      • Assess accessibility to membrane-impermeable sulfhydryl reagents

      • Map cytoplasmic versus periplasmic exposure

    • Reporter Fusion Technique:

      • Create fusion constructs with reporter proteins (GFP, alkaline phosphatase, β-lactamase)

      • Position reporters at predicted loop regions

      • Assess activity/fluorescence to determine cellular localization

    • Protease Protection Assays:

      • Treat membrane vesicles with proteases

      • Identify protected fragments by immunoblotting or mass spectrometry

      • Map regions accessible to proteolytic cleavage

  • Structural Validation:

    • Electron Crystallography:

      • Generate 2D crystals in lipid bilayers

      • Collect electron diffraction data

      • Resolve transmembrane segments

    • Site-Directed Spin Labeling EPR:

      • Introduce spin labels at specific positions

      • Measure accessibility parameters and distance constraints

      • Generate experimental constraints for topology modeling

Given the predicted membrane localization of RHE_CH02332 and its 359-amino acid length, a hybrid approach combining computational prediction with targeted experimental validation would be most resource-efficient. The resulting topology model would provide crucial insights into functional regions and potential interaction interfaces of this UPF0283 family protein .

What strategies can resolve common difficulties in expression and purification of RHE_CH02332?

Membrane proteins like RHE_CH02332 present unique challenges during expression and purification. The following table outlines common problems and their solutions:

ProblemPossible CausesTroubleshooting Strategies
Poor expression yieldToxicity to host cells1. Use tightly controlled inducible promoters
2. Lower induction temperature (16-20°C)
3. Reduce inducer concentration
4. Try C41/C43 E. coli strains designed for membrane proteins
Protein aggregation in inclusion bodiesImproper folding1. Co-express with molecular chaperones (GroEL/ES)
2. Include mild detergents in lysis buffer
3. Try extraction with different detergents (DDM, CHAPS, Triton X-100)
4. Consider fusion partners (MBP, SUMO) to enhance solubility
Low purity after affinity chromatographyNon-specific binding1. Increase imidazole in wash buffers (up to 50mM)
2. Add low concentration of detergents in wash buffers
3. Consider dual-tagging strategies
4. Implement additional purification steps (ion exchange, size exclusion)
Protein instabilityDetergent-induced destabilization1. Screen detergent types and concentrations
2. Add stabilizing agents (glycerol, specific lipids)
3. Minimize time between purification and use/storage
4. Consider amphipol or nanodisc reconstitution for increased stability
Poor reproducibility between preparationsVariation in membrane extraction1. Standardize cell growth conditions
2. Control lysis parameters (pressure, time)
3. Implement quality control for each purification step
4. Prepare larger batches with consistent protocols

Additionally, when expressing His-tagged RHE_CH02332, monitoring the accessibility of the tag is crucial. If the tag becomes buried within detergent micelles or protein aggregates, purification efficiency may be compromised, requiring optimization of tag position or extraction conditions .

How can researchers address challenges in functional characterization of RHE_CH02332 when the protein's precise function remains unknown?

When working with proteins of unknown function like RHE_CH02332, researchers can implement a systematic approach to functional characterization:

  • Phylogenetic Profiling:

    • Identify taxonomic distribution of UPF0283 family proteins.

    • Correlate presence/absence patterns with specific bacterial traits or habitats.

    • Analyze co-evolution with proteins of known function.

  • Genomic Context Analysis:

    • Examine neighboring genes and operonic organization.

    • Identify conserved genomic neighborhoods across species.

    • Infer potential functional associations from co-regulated genes.

  • Structural Homology Screening:

    • Perform structure prediction and compare with structurally characterized proteins.

    • Identify potential binding pockets or catalytic sites.

    • Use fold recognition to detect distant homologs with known functions.

  • Unbiased Interaction Screens:

    • Implement bacterial two-hybrid or pull-down mass spectrometry analyses.

    • Screen against metabolite libraries to identify potential ligands.

    • Perform lipid binding assays to test membrane-specific interactions.

  • Phenotypic Analysis:

    • Generate and characterize knockout mutants under diverse conditions.

    • Implement high-content phenotypic screening.

    • Test specific hypotheses based on initial findings (e.g., stress response, symbiosis).

  • Environmental Response Profiling:

    • Analyze expression changes under different symbiotic and free-living conditions.

    • Test response to plant-derived compounds (similar to flavonoid sensing in RHE_CH02687) .

    • Monitor protein localization changes during environmental transitions.

By combining these approaches, researchers can develop testable hypotheses about RHE_CH02332 function, particularly in the context of Rhizobium-legume symbiosis where membrane proteins often play crucial roles in signaling and nutrient exchange .

How might synthetic biology approaches be applied to investigate RHE_CH02332 function?

Synthetic biology offers innovative strategies to investigate RHE_CH02332 function through rational engineering and reconstruction approaches:

  • Domain Swapping and Chimeric Proteins:

    • Exchange domains between RHE_CH02332 and RHECIAT_CH0002430 to identify functionally important regions.

    • Create chimeras with well-characterized membrane proteins to assess domain functions.

    • Design synthetic receptors incorporating RHE_CH02332 sensing domains coupled to known output domains.

  • Minimal System Reconstruction:

    • Transfer RHE_CH02332 and potential interacting partners to heterologous hosts.

    • Reconstitute putative signaling pathways in simplified cell-free systems.

    • Design synthetic operons to study co-regulation with functionally related genes.

  • Biosensor Development:

    • Create reporter systems where RHE_CH02332 controls expression of fluorescent proteins.

    • Design split-protein complementation assays to monitor protein-protein interactions.

    • Develop membrane potential sensors linked to RHE_CH02332 activity.

  • Directed Evolution Approaches:

    • Implement error-prone PCR or DNA shuffling to generate RHE_CH02332 variants.

    • Select for enhanced function or altered specificity under defined conditions.

    • Use deep mutational scanning to map sequence-function relationships.

  • Orthogonal Expression Systems:

    • Engineer inducible, tunable expression systems for controlled RHE_CH02332 studies.

    • Implement optogenetic control for spatial and temporal regulation of protein activity.

    • Create genetic circuits that respond to RHE_CH02332-dependent signals.

These approaches can help overcome the limitations of traditional loss-of-function studies, particularly for membrane proteins where complete deletion may cause pleiotropic effects or be lethal. By precisely manipulating RHE_CH02332 structure and expression, researchers can isolate specific functions and regulatory mechanisms .

What computational approaches can predict potential functions of RHE_CH02332 based on structural bioinformatics?

Advanced computational methods can provide valuable insights into potential functions of RHE_CH02332 through integrative structural bioinformatics approaches:

  • Homology-Based Function Prediction:

    • Implement sensitive profile-based sequence searches (PSI-BLAST, HHpred) to detect remote homologs.

    • Apply threading algorithms (I-TASSER, Phyre2) to identify structural similarities despite low sequence identity.

    • Analyze conservation patterns within the UPF0283 family to identify functionally important residues.

  • Binding Site Prediction:

    • Use algorithms like FTSite, SiteMap, or CASTp to identify potential ligand-binding pockets.

    • Analyze electrostatic surface properties to predict interaction with charged molecules or proteins.

    • Implement fragment-based virtual screening to identify potential small molecule binders.

  • Molecular Dynamics Simulations:

    • Model RHE_CH02332 in realistic membrane environments using coarse-grained or all-atom simulations.

    • Analyze protein flexibility and conformational changes that might indicate functional mechanisms.

    • Simulate interactions with potential binding partners identified through other methods.

  • Network Analysis:

    • Construct protein-protein interaction networks based on co-expression data.

    • Apply graph-based algorithms to identify functional modules.

    • Implement Bayesian integration of multiple data types for function prediction.

  • Machine Learning Applications:

    • Train deep learning models on known membrane protein functions to predict RHE_CH02332 function.

    • Apply natural language processing to mine literature for functional associations with similar proteins.

    • Implement deep mutational scanning data analysis to correlate sequence variations with potential functions.

The implementation of these approaches should focus particularly on symbiosis-related functions, given the importance of Rhizobium etli in nitrogen-fixing symbiosis with legumes. Similar computational approaches successfully predicted the flavonoid-binding function of RHE_CH02687 , suggesting that these methods could identify potential signaling or transport roles for RHE_CH02332 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.