Recombinant Rhizobium etli UPF0283 membrane protein RHECIAT_CH0002430 (RHECIAT_CH0002430)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Rhizobium etli UPF0283 membrane protein RHECIAT_CH0002430, also referred to as RHE_CH02332, is a protein expressed in Rhizobium etli . It has a molecular weight of approximately 39.3 kDa . This protein is sometimes produced with a His-tag to aid in purification and detection .

Table 1: Protein Information

FeatureDescription
Gene NameRHE_CH02332, RHECIAT_CH0002430
SynonymsUPF0283 membrane protein RHE_CH02332, UPF0283 membrane protein RHECIAT_CH0002430
SpeciesRhizobium etli
Protein LengthFull Length (1-359 amino acids)
TagHis-tag (added for purification and detection)
AA SequenceMSKPPSDLPRRPPAAFAYEDEAAEPGDNGRQQQGRRRPESFSEDIVLTPDEEDPFINPDRDPSAVAVATPRKRRTSFGKIALAAFGILLSLGIGLWTDRLIRDLFSRADWLGYAALGVLAIGILAVLALVIREAAGMMRLAAVQTIKAEAEAAILETRPAKARAVVSRLTTLLAANPETSKGRATLKATEGEVIDPPHLIALAERELLAPLDRKARALIVNASKRVSIVTAVSPRAIVDLLYVLYESVRLIRAMAELYGGRPGTLGMFRLLRDVLAHLAVTGSIAVGDSLVQQVLGHGLASKLSARLGEGVINGLMTARIGIAAMDLCRPLAFRAVKRPGIGDFIGDLTPSMSPRGNNP
UniProt IDQ2K7S4, B3PPV4

Expression and Purification

The recombinant protein is produced in Escherichia coli and purified using affinity chromatography due to the presence of the His-tag .

Function and Localization

RHECIAT_CH0002430 is annotated as a UPF0283 membrane protein, indicating it contains a domain of unknown function (UPF0283) . Membrane proteins are often involved in transport, signaling, or maintaining cell structure.

Studies on Rhizobium etli have identified proteins present in the periplasmic space and outer membrane vesicles (OMVs) . OMVs are involved in protein secretion and contain proteins with diverse functions, such as:

  • Rhizobium adhering proteins (Rap)

  • Polysaccharidases

  • Polysaccharide export proteins

  • Auto-aggregation and adherence proteins

  • Glycosyltransferases

  • Peptidoglycan binding and cross-linking enzymes

  • Potential cell wall-modifying enzymes

  • Porins

  • Multidrug efflux RND family proteins

  • ABC transporter proteins

  • Heat shock proteins

Proteomic analyses of R. etli have also identified a large number of extracellular proteins with unknown functions, suggesting potential novel roles in the bacterium's interaction with its environment .

Role in Symbiosis

Rhizobium etli establishes a symbiotic relationship with leguminous plants, fixing nitrogen for the plant in exchange for nutrients . The secretome, or set of secreted proteins, of R. etli is crucial for its infection strategy and survival . One study identified 192 and 191 proteins in the exponential and stationary phases of growth, respectively, with a significant portion having unknown functions . These proteins could play a role in the adaptive response during different growth stages.

Some studies suggest that R. etli utilizes outer membrane vesicles (OMVs) as a mechanism for protein excretion . These OMVs contain proteins with varied physiological roles, potentially contributing to the bacterium's interaction with the host plant .

Potential Involvement in Efflux Pumps

Some research indicates that certain proteins in R. etli may be part of efflux pumps, which are involved in the secretion of signal molecules required for interaction with the host plant . Efflux pumps in the RND family consist of a transporter protein in the inner membrane, a membrane fusion protein in the periplasmic space, and an outer membrane protein .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RHECIAT_CH0002430; UPF0283 membrane protein RHECIAT_CH0002430
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Rhizobium etli (strain CIAT 652)
Target Names
RHECIAT_CH0002430
Target Protein Sequence
MSKPPSDPPRRPPAAFAYEDEASEPRNSGRQQQGRRKPESFSENIVVTPDEDDPFINPDS DLIAPPVATPRKRRTSFGKIAAGAFGILLSLGLGLWTDRLIRDLFTRADWLGYAALGVLA IGILAVLALVIRETAGMMRLAAVQTIKAEAEAAILETRPAKARAVLARLTTLLAANPETS KGRATLKATEGEVIDPPHLMALAERELLAPLDRKARALIVNASKRVSIVTAVSPRAVVDL LYVLYEAVRLIRAMAELYGGRPGTLGMFRLLRDVLAHLAVTGSIAVGDSLVQQVLGHGLA SKLSARLGEGVINGLMTARIGIAAMDLCRPLAFRTLKRPGIGDFIADLTPSMSPRGNNP
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • How is recombinant RHECIAT_CH0002430 protein typically expressed and purified for research applications?

    Recombinant RHECIAT_CH0002430 is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . The methodology involves:

    1. Cloning the full-length gene (1-359aa) into an appropriate expression vector

    2. Transformation into E. coli expression strains optimized for membrane proteins

    3. Induction of protein expression under controlled conditions

    4. Cell lysis, typically using detergent-based methods to solubilize membrane proteins

    5. Purification via immobilized metal affinity chromatography (IMAC) using the His-tag

    6. Additional purification steps such as size exclusion chromatography if higher purity is required

    The purified protein is often stored in buffer containing 50% glycerol with Tris-based buffer formulations at pH 8.0 . To prevent protein degradation, aliquoting and storage at -20°C/-80°C is recommended, with avoidance of repeated freeze-thaw cycles .

  • What experimental approaches are used to study RHECIAT_CH0002430's cellular localization?

    Multiple complementary approaches are employed to determine the cellular localization of RHECIAT_CH0002430:

    1. Subcellular fractionation: Sequential centrifugation steps to separate membrane fractions from cytoplasmic components, followed by Western blot analysis using antibodies against the protein or its tag.

    2. Fluorescence microscopy: Creation of GFP-fusion constructs to visualize protein distribution in living cells. Similar approaches have been used for other Rhizobium membrane proteins, revealing that many membrane proteins like nodTch (another outer membrane protein in R. etli) are localized to the bacterial outer membrane .

    3. Immunogold electron microscopy: Using gold-conjugated antibodies to visualize protein localization at ultrastructural resolution.

    4. Protease accessibility assays: Treatment of intact cells, spheroplasts, and membrane vesicles with proteases to determine protein topology.

    Studies of related membrane proteins in R. etli have demonstrated that accurate localization information can be critical for understanding protein function, particularly for those involved in transport or signaling across the bacterial envelope .

Advanced Research Questions

  • What advanced structural biology techniques have been applied to characterize RHECIAT_CH0002430's membrane topology and tertiary structure?

    Several advanced structural biology techniques can be applied to characterize the membrane topology and tertiary structure of RHECIAT_CH0002430:

    1. Native mass spectrometry (nMS): This technique has emerged as a powerful tool for studying membrane proteins in their native-like states. For RHECIAT_CH0002430, similar approaches to those used for other membrane proteins involve:

      • Reconstitution in nanodiscs or liposomes mimicking the native membrane environment

      • Direct analysis from these intact membrane mimetics

      • Determination of protein-lipid interactions and oligomeric states

    2. Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This method can identify solvent-accessible regions and conformational dynamics of membrane proteins. HDX-MS experiments typically employ:

      • Incubation of purified RHECIAT_CH0002430 in deuterated buffer

      • Quenching the exchange at low pH and temperature

      • Digestion with pepsin (which improves membrane protein sequence coverage)

      • MS analysis to identify deuterium incorporation patterns

    3. Hydroxyl radical footprinting: Fast photochemical oxidation of proteins (FPOP) using hydroxyl radicals can probe protein folding and membrane insertion. This technique has been successfully applied to membrane proteins like bacteriorhodopsin to understand chromophore-dependent structural stability .

    4. Cryo-electron microscopy: Recent advances have made it possible to determine high-resolution structures of membrane proteins directly from liposomes, offering opportunities to visualize RHECIAT_CH0002430 in a near-native lipid environment .

    Integration of multiple structural techniques is recommended, as each method provides complementary information about different aspects of membrane protein structure.

  • How can native mass spectrometry be optimized to study RHECIAT_CH0002430's interactions with membrane lipids?

    Native mass spectrometry (nMS) offers powerful capabilities for studying RHECIAT_CH0002430's interactions with membrane lipids. An optimized protocol would include:

    1. Liposome-nMS platform development:

      • Creation of customizable liposomes mimicking R. etli membrane composition

      • Reconstitution of purified RHECIAT_CH0002430 into these liposomes

      • Direct analysis of the protein-lipid complexes without prior detergent solubilization

    2. Titration experiments:

      • Systematic variation of lipid compositions to identify specific lipid preferences

      • Analysis of changes in protein oligomeric state as a function of lipid environment

      • Correlation of lipid binding with functional assays

    3. Analysis of organelle-specific interactions:

      • Reconstitution in liposomes mimicking different bacterial membrane compartments

      • Comparison of lipid binding profiles in different membrane environments

      • Determination of how membrane context affects protein structure and function

    Recent research has shown that the same membrane protein can exhibit different lipid binding specificities in different organellar membranes, which may be particularly relevant for RHECIAT_CH0002430 given R. etli's complex membrane organization .

    Data from such experiments can be analyzed to determine:

    • The specific lipids that interact directly with RHECIAT_CH0002430

    • Whether these interactions are driven by chemical specificity or biophysical membrane properties

    • How lipid binding affects protein oligomerization and function

  • What bioinformatic approaches reveal about RHECIAT_CH0002430's evolutionary conservation and potential functional relationships?

    Comprehensive bioinformatic analysis of RHECIAT_CH0002430 can provide insights into its evolutionary conservation and functional relationships:

    1. Phylogenetic analysis:

      • RHECIAT_CH0002430 belongs to the UPF0283 family of membrane proteins, which appear across various bacterial species

      • Comparison with homologs like YcjF in Escherichia coli (strain UTI89/UPEC, UniProt ID: Q1RC43) reveals evolutionary relationships

      • Sequence alignment shows conserved domains likely critical for function

    2. Genomic context analysis:

      • RHECIAT_CH0002430 is chromosomally encoded in R. etli, consistent with the observation that the chromosome in this organism encodes most functions necessary for cell growth

      • Analysis of neighboring genes can provide context for potential functional pathways

      • The R. etli genome contains multiple replicons (one chromosome and six large plasmids), with most essential genes located on the chromosome

    3. Domain prediction and functional inference:

      • Transmembrane domain prediction tools identify multiple membrane-spanning regions

      • Structural homology modeling based on related proteins with known structures

      • Identification of conserved residues that may participate in substrate binding or transport

    4. Integration with genomic databases:

      • Comparison with data from the complete 6,530,228-bp genome sequence of R. etli

      • Analysis of synteny with related alpha-proteobacteria

      • Identification of potential horizontal gene transfer events that may have contributed to the acquisition of RHECIAT_CH0002430 or its ancestors

    This multi-faceted bioinformatic approach can generate testable hypotheses about RHECIAT_CH0002430's function based on evolutionary conservation patterns and genomic context.

  • How does RHECIAT_CH0002430 potentially contribute to Rhizobium etli's symbiotic capabilities?

    While direct evidence linking RHECIAT_CH0002430 to symbiotic functions is limited, several lines of investigation suggest potential contributions to R. etli's symbiotic capabilities:

    1. Membrane protein function in symbiosis:

      • R. etli forms nitrogen-fixing nodules on common bean roots (Phaseolus vulgaris)

      • Membrane proteins play critical roles in this process, including signaling, transport, and host-microbe interactions

      • Other R. etli membrane proteins (like nodTch) are essential for bacterial survival under various conditions

    2. Comparative analysis with known symbiotic proteins:

      • The R. etli genome contains several multipartite replicons with differential roles in symbiosis

      • The chromosome encodes most functions necessary for cell growth, while many symbiotic genes are located on plasmids, particularly the symbiotic plasmid p42d

      • Comparisons between RHECIAT_CH0002430 and known symbiotic proteins may reveal functional similarities

    3. Potential roles in membrane integrity during symbiosis:

      • Successful symbiosis requires bacterial adaptation to the host environment

      • Membrane proteins may contribute to stress resistance, surface recognition, or transport functions essential during nodulation

      • Given that nodTch (another membrane protein) is essential for cell survival, RHECIAT_CH0002430 may play similarly important roles in bacterial fitness during symbiosis

    4. Experimental approaches to test symbiotic functions:

      • Creation of deletion mutants and assessment of symbiotic phenotypes

      • Protein localization studies during different stages of nodulation

      • Transcriptomic analysis to determine if expression changes during symbiotic interactions

    Understanding RHECIAT_CH0002430's potential role in symbiosis requires integrating genomic, transcriptomic, and functional data in the context of the R. etli-bean symbiotic relationship.

  • What genetic manipulation strategies are most effective for studying RHECIAT_CH0002430's function in vivo?

    Several genetic manipulation strategies can be employed to study RHECIAT_CH0002430's function in vivo:

    1. Gene deletion and complementation:

      • Creation of a clean deletion mutant using homologous recombination techniques

      • Complementation with the wild-type gene to confirm phenotype restoration

      • Expression of tagged versions for localization and interaction studies

      For R. etli, specific methodologies include:

      • Use of suicide vectors like pK18mobsacB that allow for selection of double recombination events

      • Application of I-SceI meganuclease system for precise genomic modifications

      • Selection with appropriate antibiotics (nalidixic acid, kanamycin, gentamicin, spectinomycin, or tetracycline)

    2. Site-directed mutagenesis:

      • Targeted mutation of conserved residues to identify functional domains

      • Creation of chimeric proteins by domain swapping with related UPF0283 family proteins

      • Introduction of reporter tags at specific locations to assess topology

    3. Controlled expression systems:

      • Replacement of the native promoter with inducible promoters to control expression levels

      • Construction of depletion strains for essential genes

      • Analysis of overexpression phenotypes

    4. In situ tagging strategies:

      • CRISPR-Cas9 mediated tagging at the native locus

      • Fluorescent protein fusions for live-cell imaging

      • Epitope tagging for immunoprecipitation and protein complex identification

    When designing these genetic manipulations in R. etli, consideration should be given to the multipartite genome structure and the potential for homologous recombination between repeated sequences, which has been observed in this organism and can lead to genomic rearrangements .

  • How can contradictory data about RHECIAT_CH0002430's function be reconciled through comprehensive experimental design?

    Resolving contradictory data about RHECIAT_CH0002430's function requires a multi-faceted experimental approach:

    1. Systematic phenotypic characterization:

      • Analysis of growth under diverse environmental conditions (temperature, pH, osmotic stress)

      • Assessment of membrane integrity using various membrane-disrupting agents

      • Evaluation of symbiotic capabilities with host plants

    2. Multi-omics integration:

      • Transcriptomic analysis to identify co-regulated genes

      • Proteomics to determine protein abundance and post-translational modifications

      • Metabolomics to identify changes in metabolic pathways

      • Integration of these datasets to build functional networks

    3. Protein-protein interaction studies:

      • Co-immunoprecipitation followed by mass spectrometry

      • Bacterial two-hybrid assays

      • Proximity labeling techniques (BioID, APEX2) adapted for bacterial systems

    4. Comparative analysis across strains and species:

      • Functional characterization in multiple R. etli strains

      • Heterologous expression in related alpha-proteobacteria

      • Complementation studies with homologs from other species

    5. Structural biology approaches:

      • Integration of multiple structural techniques (as described in Question 4)

      • Structure-guided mutagenesis

      • In silico molecular dynamics simulations

    A well-designed experimental matrix can help identify the source of contradictory data by systematically varying:

    • Experimental conditions (growth phase, media composition, stress factors)

    • Genetic background (wild-type vs. different mutants)

    • Methodological approaches (in vivo vs. in vitro studies)

    This comprehensive approach allows researchers to determine whether contradictions arise from technical artifacts, strain-specific effects, or context-dependent protein functions.

  • What are the recommended protocols for assessing post-translational modifications of RHECIAT_CH0002430 in different physiological conditions?

    Analysis of post-translational modifications (PTMs) of RHECIAT_CH0002430 across different physiological conditions requires specialized protocols:

    1. Sample preparation:

      • Cultivation of R. etli under various conditions relevant to its lifecycle:

        • Free-living growth in standard media

        • Microaerobic conditions (similar to nodule environment)

        • Symbiotic conditions (bacteroids isolated from nodules)

        • Stress conditions (pH, temperature, oxidative stress)

      • Rapid protein extraction using buffers containing PTM-preserving inhibitors

      • Enrichment of membrane fractions using differential centrifugation

    2. PTM-specific enrichment strategies:

      • Phosphorylation: Immobilized metal affinity chromatography (IMAC) or titanium dioxide enrichment

      • Glycosylation: Lectin affinity chromatography

      • Lipidation: Click chemistry-based approaches for modified lipids

      • Ubiquitination/SUMOylation: Antibody-based enrichment

    3. Mass spectrometry analysis:

      • Bottom-up proteomics approach:

        • Enzymatic digestion (typically trypsin combined with other proteases for improved membrane protein coverage)

        • LC-MS/MS analysis with collision-induced dissociation (CID) and electron transfer dissociation (ETD) fragmentation

        • Database searching with variable modifications

      • Top-down proteomics approach:

        • Analysis of intact protein to preserve PTM combinations

        • High-resolution mass spectrometry

        • Fragment analysis to localize modifications

    4. Validation experiments:

      • Site-directed mutagenesis of modified residues

      • Western blotting with PTM-specific antibodies

      • Functional assays comparing wild-type and PTM-deficient variants

    5. Quantitative comparison across conditions:

      • Label-free quantification

      • SILAC labeling (adapted for bacteria)

      • Targeted approaches (PRM/MRM) for specific modified peptides

    This systematic approach allows researchers to identify condition-specific PTMs and assess their functional significance for RHECIAT_CH0002430, particularly during transitions between free-living and symbiotic states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.