Recombinant Rhizobium fredii Nodulation protein nolT (nolT)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: Tag type is determined during production. Specify your desired tag type for preferential development.
Synonyms
nolT; Nodulation protein NolT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-289
Protein Length
Full Length of Mature Protein
Species
Rhizobium fredii (Sinorhizobium fredii)
Target Names
nolT
Target Protein Sequence
CKVDLYTQLQEREANEIVALLMDNGVDAVRVAGKDGTSTIQVDEKLLAFSIKLLNGKGLP RQSFKNLGEIFQGSGLIASPTEERARYVYALSEELSHTISDIDGVFSARVHVVLPHNDLL RAGDTPSSASVFIRHDAKTNLPALLPKIKMLVAESIEGLAYDKVEVVLVPVERSAQEQRS LLEPDLAQASRPIPVPLLAVAVGVGAAVFAVTCYLLFIVLGHRRRQLTGELSRVQERPGV SALAAIRKKIPALGRR
Uniprot No.

Target Background

Function
Regulates cultivar-specific nodulation in soybeans.
Protein Families
YscJ lipoprotein family
Subcellular Location
Cell outer membrane; Lipid-anchor.

Q&A

What is NolT and what genomic context does it exist in?

NolT is a nodulation protein encoded by the noIT gene, which is part of the noIXWBTUV locus located on the Sym plasmid of Rhizobium fredii. This locus plays a critical role in determining host specificity during the nitrogen-fixing symbiotic relationship between R. fredii and legume plants. The noIBTUV genes are expressed as a single transcriptional unit in R. fredii, with their promoter being inducible by flavonoid signals produced by the host plant . The transcriptional organization of this locus involves three promoters, with the noIB and noIX promoters being flavonoid-inducible, while the noIW promoter is constitutively expressed .

How does NolT contribute to host specificity in rhizobial symbiosis?

NolT, as part of the noIBTUV operon, contributes to host specificity by functioning within the molecular dialogue between rhizobia and legume plants. The protein is abundantly expressed in R. fredii USDA257 following flavonoid induction . Host specificity in legume-rhizobia symbiosis is controlled at multiple levels involving both rhizobial and host genes. While Nod factors are widely recognized as primary determinants of host specificity, other bacterial components including surface polysaccharides and secreted proteins (potentially including NolT) modulate the host range . The expression of these proteins can trigger plant immune responses in incompatible hosts, thus restricting nodulation with certain strains and cultivars .

What methodological approaches are recommended for expressing recombinant NolT protein?

For expressing recombinant NolT protein, researchers should consider both in vivo and in vitro expression systems. Based on previous research with the noIXWBTUV locus, E. coli expression systems have shown mixed results. While noIX and noIW genes were successfully expressed in E. coli in an insert- and orientation-specific manner, expression of noIBTUV (including noIT) was not detectable in this system .

For successful expression of recombinant NolT, researchers should:

  • Consider native R. fredii expression systems instead of heterologous systems

  • Include flavonoid inducers in the culture medium

  • Use appropriate antibodies for detection (anti-NoIT serum has successfully detected the protein in R. fredii extracts)

  • Verify protein size against predicted molecular weight from the nucleotide sequence

  • Include proper controls to account for potential post-translational modifications

How should researchers design experiments to study NolT function in host-specificity?

When designing experiments to study NolT function in host specificity, researchers should employ a comprehensive approach that combines genetic, biochemical, and plant assay techniques:

  • Experimental Design Elements:

    • Use a completely randomized design (CRD) when working with homogeneous experimental material in laboratory conditions

    • Implement randomized block design when environmental variations need to be controlled

    • Ensure adequate replication (minimum 3-6 biological replicates) for statistical validity

  • Genetic Approaches:

    • Create targeted mutations in the noIT gene

    • Develop complementation strains to verify phenotypes

    • Perform site-directed mutagenesis to identify critical residues

  • Plant Assay Methods:

    • Compare nodulation patterns between wild-type and mutant strains

    • Evaluate early infection events (root hair curling, infection thread formation)

    • Assess nodule development and nitrogen fixation capacity

  • Controls:

    • Include both positive controls (compatible rhizobial strains) and negative controls (known incompatible strains)

    • Use soybean genotypes with different R gene configurations (Rj2/rfg1, rj2/Rfg1, and rj2/rfg1)

What controls are essential when studying NolT expression patterns?

When investigating NolT expression patterns, the following controls are essential:

  • Induction Controls:

    • Non-induced cultures (without flavonoids)

    • Time-course sampling to capture expression dynamics

    • Different flavonoid types/concentrations to assess specificity

  • Genetic Controls:

    • Wild-type R. fredii strains

    • Mutants in regulatory genes affecting noIT expression

    • Strains with reporter gene fusions to monitor promoter activity

  • Technical Controls:

    • Housekeeping gene expression for normalization in transcriptional studies

    • Protein loading controls for immunoblotting

    • Pre-immune serum controls for antibody specificity

  • Host Plant Variables:

    • Different legume genotypes (compatible vs. incompatible)

    • Plants with mutations in symbiosis-related genes

    • Non-legume controls when appropriate

How can researchers optimize detection methods for NolT protein?

Optimizing detection methods for NolT protein requires attention to several technical considerations:

  • Antibody Production Strategy:

    • Generate polyclonal antibodies against the whole NolT protein

    • Consider developing peptide antibodies targeting unique epitopes

    • Verify antibody specificity against recombinant protein and native extracts

  • Protein Extraction Optimization:

    • Use buffers containing protease inhibitors to prevent degradation

    • Optimize lysis conditions based on subcellular localization

    • Consider membrane fractionation if NolT associates with membranes

  • Detection Methods Comparison:

    MethodAdvantagesLimitationsOptimal Application
    Western blotSpecific detection, size determinationSemi-quantitativeProtein expression analysis
    ELISAQuantitative, high-throughputLacks size informationQuantification studies
    Mass spectrometryHighly specific, identifies modificationsComplex sample preparationDetailed protein characterization
    ImmunofluorescenceLocalization informationRequires specific antibodiesCellular localization studies
  • Sensitivity Enhancement:

    • Use enhanced chemiluminescence for Western blots

    • Consider protein concentration steps for low-abundance samples

    • Implement signal amplification systems when necessary

What evidence suggests NolT may function as a T3SS effector protein?

Several lines of evidence suggest NolT may function as a T3SS effector protein:

  • The noIXWBTUV locus is associated with host specificity at both species and cultivar levels, similar to the role of T3SS effectors in other rhizobia .

  • Many rhizobial strains possess a T3SS that delivers effector proteins (Nops) into host cells to modulate host range . The characteristics of NolT expression align with patterns seen in other T3SS effectors.

  • Experiments with T3SS mutants, such as the RhcU-deficient DH4 mutant of S. fredii USDA257, show that disruption of T3SS function alters nodulation patterns on soybean genotypes with different R gene configurations . This indicates that proteins like NolT may be delivered through this system.

  • The flavonoid-inducible expression of NolT matches the regulatory patterns observed for known T3SS effectors in rhizobia, which are typically induced by plant signals .

How can researchers determine if NolT is secreted through the T3SS?

To determine if NolT is secreted through the T3SS, researchers should employ a multi-faceted experimental approach:

  • Secretion Assays:

    • Culture rhizobia in minimal medium with flavonoid inducers

    • Separate bacterial cells from culture supernatant

    • Analyze supernatant for presence of NolT by immunoblotting

    • Compare wild-type strains with T3SS mutants (e.g., RhcU mutants)

  • Translocation Assays:

    • Create NolT fusion proteins with reporter tags (e.g., adenylate cyclase)

    • Measure reporter activity in plant cells after inoculation

    • Use immunogold labeling with electron microscopy to visualize protein localization

  • Bioinformatic Analysis:

    • Analyze NolT sequence for T3SS secretion signals

    • Compare with known T3SS effector properties

    • Perform structural predictions to identify potential functional domains

  • Genetic Approaches:

    • Create strains with mutations in T3SS components

    • Assess NolT secretion in these backgrounds

    • Complement mutants to confirm specificity of effects

What advanced methods can identify NolT interaction partners in planta?

Identifying NolT interaction partners in planta requires sophisticated techniques that can detect protein-protein interactions in the context of the symbiotic relationship:

  • Co-Immunoprecipitation (Co-IP):

    • Extract proteins from nodules or infected roots

    • Immunoprecipitate using anti-NolT antibodies

    • Identify co-precipitated proteins by mass spectrometry

    • Validate interactions with reverse Co-IP

  • Yeast Two-Hybrid Screening:

    • Use NolT as bait against libraries of legume proteins

    • Focus on proteins expressed during early symbiotic stages

    • Validate positive interactions with additional methods

  • Bimolecular Fluorescence Complementation (BiFC):

    • Create fusion constructs of NolT and candidate interactors

    • Express in plant cells through Agrobacterium-mediated transformation

    • Visualize interactions through reconstituted fluorescence

  • Proximity-Dependent Biotin Identification (BioID):

    • Fuse NolT to a biotin ligase

    • Express in planta during symbiotic interaction

    • Identify biotinylated proteins that were in proximity to NolT

    • This method is particularly valuable for transient or weak interactions

How do plant R genes recognize rhizobial effectors like NolT?

Plant R genes recognize rhizobial effectors through mechanisms similar to those used in pathogen recognition:

  • The discovery that soybean genes Rj2 and Rfg1 (which restrict nodulation with specific strains of Bradyrhizobium japonicum and Sinorhizobium fredii, respectively) encode TIR-NBS-LRR resistance proteins demonstrates that plants use typical R proteins to recognize rhizobial effectors .

  • These R proteins likely detect either the effector proteins directly or the effects of these effectors on host cellular targets, triggering defense responses that block symbiosis establishment .

  • In incompatible interactions controlled by Rj2 or Rfg1 genes, rhizobial strains can induce root hair curling and occasionally nodule primordium formation, but infection thread formation fails, suggesting that defense responses are triggered at this stage .

  • The recognition process appears similar to effector-triggered immunity (ETI) in plant-pathogen interactions, where R proteins detect pathogen effectors and initiate defense responses .

What experimental approaches can differentiate between compatible and incompatible host-rhizobia interactions involving NolT?

To differentiate between compatible and incompatible interactions involving NolT, researchers should employ multiple complementary approaches:

  • Microscopic Analysis:

    • Examine root hair curling and infection thread formation

    • Track bacterial progression using fluorescently labeled strains

    • Quantify aborted infection events at different developmental stages

  • Molecular Markers of Plant Defense:

    • Measure expression of defense-related genes (PR proteins, pathogenesis-related transcription factors)

    • Assess production of reactive oxygen species

    • Monitor calcium spiking patterns during early infection

  • Comparative Studies:

    ParameterCompatible InteractionIncompatible InteractionMeasurement Method
    Infection threadsNumerous, extendedFew, abortedMicroscopy with staining
    Defense gene expressionLow/transientHigh/sustainedqRT-PCR, RNA-seq
    Nodule formationNormal developmentLimited or absentCounting, weight measurement
    Bacterial proliferationHigh numbersRestricted growthCFU counts, qPCR
  • Genetic Manipulation:

    • Create NolT variants with modified domains

    • Test these variants in plants with different R gene configurations

    • Map the specific regions of NolT recognized by plant R proteins

How can contradictory data about NolT function be reconciled through advanced experimental design?

Contradictory data about NolT function can be reconciled through carefully designed experiments that address potential sources of variation:

  • Systematic Variation Analysis:

    • Implement factorial experimental designs to test multiple variables simultaneously

    • Use Latin Square Design when two sources of variation need to be controlled

    • Apply ANOVA to properly partition sources of variation

  • Strain and Genetic Background Considerations:

    • Test NolT function across multiple rhizobial strains

    • Evaluate effects in different plant genotypes with known R gene configurations

    • Create isogenic strains differing only in NolT to eliminate confounding variables

  • Environmental Condition Standardization:

    • Control temperature, light, humidity, and nutrient conditions

    • Assess phenotypes under stress and optimal conditions

    • Document all environmental parameters thoroughly

  • Molecular Function Validation:

    • Combine genetic knockout studies with complementation

    • Perform domain swapping with related proteins

    • Use site-directed mutagenesis to test structure-function hypotheses

How can structural biology approaches enhance understanding of NolT function?

Structural biology approaches can significantly advance understanding of NolT function through:

  • Protein Structure Determination:

    • X-ray crystallography of purified recombinant NolT

    • Cryo-electron microscopy for complex structures

    • NMR spectroscopy for dynamic regions and interactions

  • Structure-Function Analysis:

    • Map functional domains through truncation studies

    • Identify critical residues through point mutations

    • Compare structures with homologous proteins

  • Molecular Dynamics Simulations:

    • Model NolT interactions with potential targets

    • Predict conformational changes upon binding

    • Simulate effects of mutations on protein stability

  • In silico Docking Studies:

    • Predict interactions with R proteins or other plant targets

    • Screen for potential inhibitors or enhancers

    • Guide rational design of modified proteins for functional testing

What mechanisms might explain differential responses to NolT across legume species?

Differential responses to NolT across legume species may be explained by several mechanisms:

  • Variation in R Gene Repertoires:

    • Different legume species possess distinct sets of R genes

    • Polymorphisms in R gene sequences affect recognition specificity

    • Copy number variation influences detection sensitivity

  • Divergence in Downstream Signaling:

    • Species-specific differences in defense response pathways

    • Variation in integration of symbiosis and defense signaling

    • Different thresholds for activation of defense responses

  • Co-evolution with Rhizobial Partners:

    • Legume species have co-evolved with specific rhizobial populations

    • This may lead to tolerance of certain effector proteins

    • Molecular arms race drives diversification of both R genes and effectors

  • Interaction with Other Symbiotic Processes:

    • Cross-talk between Nod factor perception and effector recognition

    • Variation in ability of surface polysaccharides to suppress defense responses

    • Differences in developmental timing of susceptibility to effector-triggered immunity

What computational approaches can predict the evolutionary trajectory of NolT across rhizobial species?

Computational approaches to predict the evolutionary trajectory of NolT should include:

  • Phylogenetic Analysis:

    • Construct phylogenetic trees of NolT across rhizobial species

    • Compare with species phylogeny to identify horizontal gene transfer events

    • Analyze selection pressure through dN/dS ratio calculations

  • Comparative Genomics:

    • Examine synteny of genomic regions containing noIT

    • Identify gene gain/loss patterns across related species

    • Analyze association with other symbiosis-related genes

  • Structural Evolution Modeling:

    • Use homology modeling to predict structures across species

    • Identify conserved vs. variable regions

    • Model how mutations might affect protein function

  • Co-evolutionary Analysis:

    • Detect correlated evolution between NolT and plant R proteins

    • Identify potential molecular interfaces under selection

    • Predict future evolutionary trajectories based on current patterns

How can researchers address the challenge of studying proteins with low expression levels like NolT?

To address challenges in studying low-abundance proteins like NolT, researchers should consider:

  • Expression Enhancement Strategies:

    • Optimize induction conditions (type and concentration of flavonoids)

    • Use strong promoters for recombinant expression

    • Consider codon optimization for heterologous expression systems

  • Enrichment Techniques:

    • Develop affinity purification methods using epitope tags

    • Implement subcellular fractionation to concentrate target proteins

    • Use protein concentration techniques before analysis

  • Sensitive Detection Methods:

    • Employ enhanced chemiluminescence for Western blots

    • Consider mass spectrometry with targeted multiple reaction monitoring

    • Use proximity ligation assays for in situ detection

  • Alternative Approaches:

    • Study NolT function through genetic approaches when protein detection is challenging

    • Use transcriptional reporters as proxies for protein expression

    • Employ computational predictions to guide experimental design

What statistical approaches are most appropriate for analyzing variable nodulation phenotypes?

For analyzing variable nodulation phenotypes in NolT research, the following statistical approaches are recommended:

  • Appropriate Experimental Design:

    • Use randomized complete block design to control environmental variation

    • Ensure adequate sample sizes based on power analysis

    • Include multiple biological and technical replicates

  • Statistical Models:

    • Apply mixed-effects models to account for random and fixed factors

    • Use non-parametric tests when data doesn't meet normality assumptions

    • Implement multivariate approaches for complex phenotypic data

  • Data Transformation Considerations:

    • Log-transform count data when appropriate

    • Use arc-sine transformation for percentage data

    • Consider rank-based methods for highly skewed distributions

  • Advanced Analysis Approaches:

    Analytical MethodApplicationAdvantages
    ANOVAComparison across multiple treatmentsPartitions sources of variation
    Regression analysisDose-response relationshipsQuantifies relationships between variables
    Principal component analysisMulti-dimensional phenotypingReduces dimensionality of complex data
    Bayesian approachesIntegration of prior knowledgeHandles uncertainty and small sample sizes

How can researchers develop standardized assays to compare NolT function across different laboratories?

Developing standardized assays for NolT function requires establishing consensus on several key elements:

  • Reference Materials:

    • Create and distribute reference strains (wild-type and mutants)

    • Develop standardized antibodies or detection reagents

    • Establish common plant seed stocks for host response studies

  • Protocol Standardization:

    • Define detailed protocols for protein extraction and detection

    • Standardize growth conditions for both bacteria and plants

    • Establish uniform scoring systems for phenotypic assessments

  • Data Reporting Requirements:

    • Specify essential metadata to be included with results

    • Define minimum quality control parameters

    • Establish data formats to facilitate comparison

  • Collaborative Validation:

    • Conduct multi-laboratory validation studies

    • Identify sources of inter-laboratory variation

    • Refine protocols to minimize non-biological variability

How might CRISPR-Cas technologies advance functional studies of NolT?

CRISPR-Cas technologies offer several powerful approaches for advancing NolT functional studies:

  • Precise Genetic Manipulation:

    • Create clean deletions or point mutations in the noIT gene

    • Introduce mutations that affect specific domains without polar effects

    • Develop knockin strains with tagged versions of NolT

  • Multiplex Editing:

    • Simultaneously target multiple genes in the noIXWBTUV locus

    • Create combinatorial mutants to study genetic interactions

    • Develop libraries of variants for high-throughput functional screening

  • Regulatory Studies:

    • Use CRISPR interference (CRISPRi) to modulate noIT expression

    • Target promoter regions to study transcriptional regulation

    • Implement CRISPR activation (CRISPRa) to enhance expression

  • Plant Partner Manipulation:

    • Edit legume R genes to alter recognition specificity

    • Modify downstream signaling components

    • Create reporter plants with CRISPR-based sensors for NolT activity

What integrative approaches could reveal NolT's role in the broader symbiotic signaling network?

Integrative approaches to position NolT within the broader symbiotic signaling network should include:

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Map temporal dynamics during symbiosis establishment

    • Identify network motifs and regulatory hubs

  • Systems Biology Modeling:

    • Develop mathematical models of signaling networks

    • Simulate perturbations to predict system behaviors

    • Identify critical nodes and potential intervention points

  • Comparative Biology:

    • Analyze NolT function across diverse rhizobial-legume partnerships

    • Compare with analogous systems in other symbioses

    • Identify conserved and divergent signaling elements

  • Spatial and Temporal Resolution:

    • Implement live-cell imaging with fluorescent reporters

    • Use single-cell approaches to capture cellular heterogeneity

    • Develop methods for spatiotemporal tracking of signaling events

How might synthetic biology approaches advance our understanding of NolT function?

Synthetic biology approaches offer innovative strategies for understanding NolT function:

  • Minimal Functional Systems:

    • Reconstruct minimal NolT-dependent signaling systems

    • Test function in heterologous organisms

    • Identify essential components and interactions

  • Protein Engineering:

    • Create chimeric proteins to map functional domains

    • Develop biosensors based on NolT recognition elements

    • Design orthogonal systems to test specificity constraints

  • Artificial Regulatory Circuits:

    • Build synthetic circuits controlling NolT expression

    • Implement feedback loops mimicking natural regulation

    • Test hypotheses about dynamic regulation

  • Host Range Engineering:

    • Modify NolT to alter host specificity profiles

    • Test engineered variants in diverse plant backgrounds

    • Develop predictive rules for host-range determination

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.