Recombinant Rhizobium fredii Nodulation protein nolW (nolW)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
nolW; Nodulation protein NolW
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-234
Protein Length
full length protein
Species
Rhizobium fredii (Sinorhizobium fredii)
Target Names
nolW
Target Protein Sequence
MPTTPIPFTPLHMFRRLLCVGLFLFAGIHTTLGATLPLPSTSYKYTVLDQDLSAALQEFG NNLKISVNISAEVKGRIRGRIPELSPREFLDRLTDLYDLQWYYDGVVLYVSAAKEAQTRM LVLSSVHFSAFKLALDKLDISDERYPVRPAPGNGLVLVSGPPRFIALIEQTLNGLLAVAQ AQPRATDTPARESVMVLFRGSSTTVVRGGRPEVFYTSEMLPENDDGGKAELSKK
Uniprot No.

Target Background

Function
Regulates cultivar-specific nodulation in soybeans.
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is nolW and what is its genetic context in Rhizobium fredii?

NolW is a nodulation protein that functions as part of the host specificity determination system in Rhizobium fredii (also classified as Sinorhizobium fredii). It belongs to the nolXWBTUV locus located on a Sym plasmid, which restricts the host range of R. fredii USDA257 at both the host species and cultivar level . This locus is particularly important because it determines whether certain strains can form nitrogen-fixing nodules on specific soybean cultivars. For example, R. fredii USDA257 produces nitrogen-fixing nodules on primitive soybean cultivars such as Peking but fails to nodulate agronomically improved cultivars like McCall .

The genetic organization of this locus is quite distinctive. The nolW gene is part of a complex transcriptional unit where nolXWBTUV are transcribed from three promoters. Two promoters upstream of nolW and nolBTUV are oriented face to face and initiate transcription at sites that are 14 bp apart, while the third lies upstream from nolX . The initiation codon for nolW lies 155 bp upstream from that of nolB, and it is separated from nolX by 281 bp. Interestingly, nolW and nolX are of opposite polarity to the nolBTUV genes .

How conserved is nolW across different rhizobial species?

This conservation pattern aligns with the role of nolW in host specificity, as different rhizobial species have evolved diverse mechanisms to interact with their respective host plants. The presence of nolW in both R. fredii and NGR234 may reflect their overlapping host ranges or shared evolutionary history .

What are the optimal methods for expressing recombinant nolW protein?

Recombinant nolW protein can be successfully expressed using several approaches, with E. coli being the preferred heterologous host. The following protocol has been effectively employed:

  • Vector construction: The full-length nolW gene (encoding amino acids 1-234) is cloned into an expression vector with an N-terminal His-tag fusion.

  • Expression conditions: The recombinant protein is expressed in E. coli under standard induction conditions, typically using IPTG for T7 or similar promoter systems.

  • Protein purification: Since nolW contains putative membrane-spanning regions, careful optimization of solubilization conditions may be necessary. Standard His-tag purification protocols using nickel affinity chromatography are effective.

  • Storage and stability: After purification, the protein can be stored as a lyophilized powder or in a Tris/PBS-based buffer with 6% trehalose at pH 8.0. For long-term storage, adding 5-50% glycerol (final concentration) and storing at -20°C/-80°C is recommended. Repeated freeze-thaw cycles should be avoided .

For researchers encountering solubility issues, expression as a fusion protein with solubility enhancers like MBP (maltose-binding protein) or SUMO may improve yields of functional protein.

What mutagenesis approaches are most effective for studying nolW function?

Several genetic approaches have been successfully applied to study nolW function, each with specific advantages:

  • Site-directed mutagenesis: The use of mudII1734 has confirmed that inactivation of nolW (along with nolB, nolT, nolU, nolV, or nolX) extends host range for nodulation to McCall soybean . This approach allows precise modification of specific residues to study structure-function relationships.

  • Transposon mutagenesis: The transposon mutant 257DH4 has been created by inserting Tn5 into the nolXWBTUV locus, resulting in new phenotypes including the ability to nodulate McCall soybeans and sensitivity to competitive nodulation blocking . This approach is useful for initial identification of gene functions.

  • CRISPR/Cas9-mediated gene knockouts: Modern studies employ CRISPR/Cas9 technology to disrupt gene function with high precision. This approach has been successfully used for related symbiosis genes like Rfg1 and could be applied to nolW for clean deletions or targeted modifications.

  • T3SS mutants: Studying broader Type III secretion system (T3SS) mutants, such as the RhcU function mutant DH4 which fails to secrete any effector proteins, provides valuable context for understanding nolW's role within this system .

When designing mutagenesis experiments, researchers should consider:

  • Creating both null mutations and targeted substitutions of key residues

  • Complementation tests to confirm phenotypes are due to the intended mutation

  • Analysis of potential polar effects on downstream genes

  • Phenotypic characterization across multiple host plants to fully understand host range effects

How can researchers detect nolW expression and localization in planta?

Detecting nolW expression and localization during symbiosis requires specialized techniques:

  • Reporter gene fusions: Histochemical staining of roots inoculated with nolW-lacZ fusions can verify gene expression patterns throughout nodule development. Similar approaches with nolB, nolU, and nolX have successfully tracked expression from preinfection to the functional nodule stage .

  • RT-PCR and qRT-PCR: Transcriptional analysis can quantify nolW expression in plants during different stages of symbiosis. This approach has shown that related genes in the same locus are not expressed in mature nodules .

  • Immunocytochemical detection: Antibodies raised against nolW can be used for immunostaining of paraffin-embedded sections of developing nodules. Similar approaches with NolX antibodies have localized the protein in infection threads .

  • Protein A-gold immunocytochemical localization: This high-resolution technique uses affinity-purified antibodies to precisely locate proteins in subcellular structures. For NolX, gold particles were detected in fibrillar material inside infection threads , and similar approaches could be applied to nolW.

  • Fluorescent protein fusions: Creating translational fusions between nolW and fluorescent proteins like GFP can allow real-time visualization of protein localization during infection.

For optimal results, researchers should combine multiple techniques and include appropriate controls to distinguish between background and specific signals, especially when working with the complex microenvironment of developing nodules.

What are the challenges in analyzing nolW protein interactions?

Understanding nolW's protein interaction network presents several technical challenges:

  • Membrane association: The predicted membrane-spanning regions of nolW make it difficult to study using standard protein interaction techniques optimized for soluble proteins. Specialized approaches for membrane proteins are often required.

  • Temporal dynamics: Since nolW likely functions primarily during early nodulation stages rather than in mature nodules , timing of sample collection is critical for capturing relevant interactions.

  • Complex formation: As part of the T3SS, nolW may participate in large, multi-protein complexes that are difficult to isolate intact.

  • Plant-bacteria interface: If nolW mediates interactions between bacterial and plant proteins, capturing these cross-kingdom interactions requires specialized approaches.

To overcome these challenges, researchers can employ:

  • Membrane-specific protein interaction techniques like membrane yeast two-hybrid

  • Crosslinking approaches to stabilize transient interactions

  • Proximity labeling methods such as BioID or APEX to identify proteins in close proximity to nolW

  • Split-reporter systems like BiFC for in vivo visualization of interactions

  • Computational prediction followed by targeted validation of high-confidence candidates

How does nolW contribute to host specificity in rhizobium-legume symbiosis?

NolW plays a key role in determining which legume hosts can form functional symbioses with specific Rhizobium strains. Multiple lines of evidence illustrate this function:

  • Genetic evidence: Site-directed mutagenesis confirms that inactivation of nolW extends the host range of R. fredii USDA257 to include previously incompatible soybean cultivars like McCall . This clearly demonstrates nolW's restrictive role in host specificity.

  • Type III secretion system (T3SS) connection: As part of the nolXWBTUV locus, nolW functions within the T3SS, which delivers bacterial effector proteins directly into host cells . This system appears to be central to cultivar-specific nodulation.

  • Plant immune response engagement: The host specificity mediated by nolW likely involves interaction with plant immunity. Soybean cultivars that restrict nodulation with certain rhizobial strains express TIR-NBS-LRR resistance proteins encoded by genes like Rfg1 .

  • Timing of action: Expression patterns indicate that nolW and related proteins function during early nodule development but not in mature nodules , consistent with a role in determining initial compatibility rather than ongoing symbiotic function.

The current model suggests that in incompatible interactions, components of the T3SS or the effectors it delivers are recognized by plant immune receptors, triggering defense responses that block nodulation. Mutation of nolW disrupts this system, preventing recognition and allowing nodulation to proceed in otherwise incompatible host genotypes .

What is the relationship between nolW and the Type III Secretion System?

NolW is integrally connected to the Type III Secretion System (T3SS) in Rhizobium fredii:

  • Genetic organization: The nolW gene is part of the nolXWBTUV locus, which encodes components of the T3SS in R. fredii USDA257 . This secretion system is a specialized protein delivery apparatus that allows bacteria to inject effector proteins directly into host cells.

  • Structural role: The predicted membrane-spanning regions of nolW suggest it may be a structural component of the T3SS apparatus . While the exact function is not fully characterized, it may contribute to the formation of the secretion channel or associated structures.

  • Regulatory aspects: The nolW promoter is constitutive, unlike the flavonoid-inducible promoters of nolB and nolX . This distinctive regulation suggests nolW may have functions beyond those directly regulated by plant signals, perhaps in maintaining basal T3SS structure.

  • Phenotypic consequences: Mutations in the T3SS, including those affecting nolW, alter host specificity. For example, the T3SS mutant DH4, which fails to secrete any effector proteins, gained the ability to nodulate soybean genotypes carrying an Rfg1 allele .

This relationship with the T3SS places nolW in a pivotal position between symbiotic and pathogenic mechanisms. While pathogens use T3SS to deliver virulence factors, rhizobia appear to have adapted this system to modulate host specificity in symbiosis, highlighting the fine line between beneficial and pathogenic plant-microbe interactions.

How do mutations in nolW affect nodulation and nitrogen fixation?

Mutations in nolW lead to several distinct phenotypic changes in the Rhizobium-legume interaction:

  • Extended host range: The most striking effect of nolW mutation is the extension of host range to previously incompatible soybean cultivars. Specifically, inactivation of nolW allows R. fredii USDA257 to nodulate improved North American cultivars like McCall .

  • Competitive nodulation phenotypes: NolW mutants show sensitivity to competitive nodulation blocking by the parental strain . This phenomenon suggests that the wild-type strain can interfere with the nodulation ability of the mutant, possibly through competition for infection sites or signaling interference.

  • Normal nitrogen fixation in compatible interactions: Since nolXWBTUV locus mutants form functional nitrogen-fixing nodules on their hosts, this locus may not have a direct role in the nitrogen fixation process itself . This indicates that nolW primarily affects the establishment of symbiosis rather than its maintenance or function.

  • Altered infection thread development: While specific data for nolW mutants is limited, studies of the wild-type interaction show that on incompatible cultivars, R. fredii USDA257 forms abnormal infection threads with bacteria failing to be released into host cells . Mutations in nolW likely affect this process, allowing normal infection thread development and bacterial release.

These observations suggest that nolW's primary function is in determining compatibility during early infection stages rather than in later stages of nodule development or nitrogen fixation itself. The protein appears to be part of a system that can either promote or restrict nodulation depending on the host genotype.

How does nolW expression change under different symbiotic conditions?

The expression pattern of nolW provides crucial insights into its functional timing and context:

  • Promoter characteristics: The nolW gene is transcribed from a constitutive promoter, unlike the flavonoid-inducible promoters that control nolB and nolX . This suggests nolW may have functions beyond those directly regulated by plant signals during symbiosis initiation.

  • Temporal expression: While specific expression data for nolW is limited, studies of related proteins in the same locus indicate expression during early stages of nodule development but not in mature nodules. For example, NolX is present in developing infection threads but absent from mature nodules .

  • Spatial expression: Histochemical staining of roots inoculated with gene fusions (shown for nolB, nolU, and nolX) demonstrates expression from preinfection to the functional nodule stage . Similar patterns are likely for nolW given its genetic linkage and functional relationships.

  • Host-dependent expression: The expression or activity of nolW and related proteins may differ between compatible and incompatible host plants, contributing to the differential outcomes of these interactions.

This expression pattern is consistent with a role for nolW in early determination of host compatibility rather than in ongoing symbiotic function. The constitutive expression of nolW versus the inducible expression of other genes in the locus suggests a complex regulatory network fine-tuned to coordinate T3SS assembly and function during symbiosis.

What is the molecular mechanism by which nolW restricts nodulation in specific host genotypes?

Current evidence points to a mechanism involving effector-triggered plant immunity:

  • R gene interaction model: The restriction of nodulation appears to involve a mechanism similar to pathogen recognition in plant immunity. The Rfg1 gene in soybeans encodes a TIR-NBS-LRR class plant resistance protein that restricts nodulation by S. fredii strains including USDA257 .

  • T3SS effector hypothesis: As part of the T3SS, nolW likely contributes to the delivery of bacterial effectors that are recognized by plant immune receptors (like Rfg1) in resistant cultivars. This recognition triggers defense responses that block nodulation progression .

  • Infection thread arrest: In incompatible interactions, infection threads develop abnormally, and bacteria fail to be released into host cells . This suggests that the plant immune response activated by T3SS effectors specifically targets the infection process.

  • Bypass through mutation: When nolW or other T3SS components are mutated, the system fails to deliver the effectors that would trigger plant immunity, allowing infection to proceed in otherwise incompatible hosts .

  • Balance with symbiotic signaling: The establishment of symbiosis appears to require a balance between immune suppression by symbiotic signals (like Nod factors) and avoidance of immune activation by effectors. While Nod factors may suppress some defense responses, they cannot overcome effector-triggered immunity .

This molecular model explains why the host restriction phenotype could not be genetically separated from sensitivity to competitive nodulation blocking - both phenomena likely reflect the same underlying recognition mechanism.

How has the co-evolution of nolW and plant R genes shaped legume-rhizobia symbiotic specificity?

The interaction between nolW (as part of the T3SS) and plant R genes represents a fascinating co-evolutionary relationship:

  • Parallel with pathogen systems: The involvement of TIR-NBS-LRR resistance proteins in controlling rhizobial symbiosis reveals common recognition mechanisms underlying symbiotic and pathogenic host-bacteria interactions . This suggests either convergent evolution or that symbiotic relationships evolved from pathogenic ones.

  • Diversifying selection: The limited distribution of nolW across rhizobial species and the presence of multiple R genes in legumes controlling different aspects of host specificity suggest ongoing diversifying selection in both partners.

  • Geographic patterns: The observation that improved North American soybean cultivars restrict nodulation with certain S. fredii strains while primitive Asian cultivars permit it points to geographic co-evolution patterns, possibly reflecting adaptation to different soil rhizobial communities.

  • Functional trade-offs: The maintenance of host specificity genes despite their apparent restriction of potential hosts suggests selective advantages, possibly including:

    • Optimized nitrogen fixation efficiency with specific partners

    • Protection against exploitation by ineffective rhizobia

    • Coordination with other aspects of plant physiology and development

  • Molecular arms race: The dynamic between bacterial effectors and plant R genes may represent a form of molecular arms race, where changes in effectors are countered by changes in R genes, driving ongoing evolution of specificity.

Understanding this co-evolutionary history could provide insights into the origins of symbiosis and guide efforts to optimize nitrogen fixation in agricultural systems.

How might understanding nolW function contribute to engineering improved nitrogen-fixing symbioses?

Knowledge of nolW and its role in host specificity offers several promising avenues for agricultural applications:

  • Expanding host range of elite strains: Targeted modification or deletion of nolW could extend the host range of elite rhizobial strains with superior nitrogen fixation capabilities, allowing them to nodulate a wider range of crop varieties .

  • Developing broader-spectrum inoculants: Engineering rhizobial inoculants without the restrictive effects of the T3SS could create "universal" strains capable of effectively nodulating diverse soybean cultivars.

  • Overcoming competitive nodulation barriers: Understanding competitive nodulation blocking mechanisms related to nolW function could help design inoculants that effectively compete with indigenous soil rhizobia.

  • Crop improvement strategies: Knowledge of how plant R genes restrict nodulation could guide breeding or genetic engineering of crop varieties with optimized partner selection, favoring the most efficient nitrogen-fixing strains.

  • Transferring symbiotic capabilities: Deep understanding of the molecular determinants of compatibility could eventually support efforts to extend nitrogen fixation capabilities to non-legume crops, addressing one of the major challenges in sustainable agriculture.

These applications require careful consideration of ecological impacts and extensive field testing to ensure that modified symbioses maintain efficiency and stability under diverse environmental conditions.

What techniques can resolve contradictory findings about nolW function across different experimental systems?

Researchers investigating nolW function sometimes encounter seemingly contradictory results. The following methodological approaches can help resolve these discrepancies:

  • Standardized genetic backgrounds: Use identical parent strains and create isogenic mutants differing only in the gene of interest to eliminate confounding variables from different genetic backgrounds.

  • Controlled plant growth conditions: Standardize plant growth conditions (light, temperature, humidity, soil composition) as these can significantly affect nodulation outcomes and potentially mask or exaggerate genetic effects.

  • Temporal analyses: Conduct time-course experiments to distinguish between effects on timing versus absolute capacity for nodulation, as some phenotypes may represent delays rather than complete blocks.

  • Multi-omics approaches: Combine genomics, transcriptomics, proteomics, and metabolomics to build comprehensive models of nolW function in different contexts.

  • Cross-laboratory validation: Establish collaborative networks to test identical strains and plant genotypes across different laboratories, identifying environment-specific effects.

  • Formal meta-analysis: When sufficient published data exists, conduct formal meta-analyses to identify patterns across studies and factors associated with variations in outcomes.

  • Single-cell techniques: Apply single-cell approaches to detect heterogeneity within bacterial populations or plant responses that might explain variable outcomes.

These methodological approaches can help reconcile conflicting findings and build a more robust understanding of nolW function across different experimental systems and biological contexts.

Table 1: Characteristics of nolW and Related Genes in the nolXWBTUV Locus

GeneProtein SizePredicted FunctionPromoter TypeExpression PatternEffect of MutationNotable Features
nolW234 aaMembrane-associated componentConstitutiveThroughout nodule developmentExtends host rangeLimited homology to NodH of R. meliloti
nolXLarger than initially predictedSecreted proteinFlavonoid-inducibleEarly nodule development onlyExtends host rangeHomology to HrpF of X. campestris
nolB--Flavonoid-inducibleFrom preinfectionExtends host range-
nolT-Membrane-spanning--Extends host rangePutative membrane-spanning regions
nolU---From preinfectionExtends host range-
nolV----Extends host range-

Data compiled from references , , and

Table 2: Expression and Purification of Recombinant nolW Protein

Expression SystemVector TypeTagHostStorage RecommendationsPurification MethodKey Considerations
Full-length (1-234 aa)-N-terminal His-tagE. coliLyophilized or Tris/PBS buffer with 6% trehalose, pH 8.0Metal affinity chromatographyAvoid repeated freeze-thaw cycles
Full-length (1-234 aa)-His-tagE. coli5-50% glycerol, -20°C/-80°C-Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

Data sourced from reference

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.