Recombinant Rhizobium leguminosarum bv. trifolii ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare your order accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; Rleg2_0512; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Target Names
atpB
Target Protein Sequence
MSNDPTHQFQIFKIVPIEIGGIDFSFTNASLFMAASAAVAVGFLYFATSNRAIVPGRSQS VAEMSYEFIANMLKEGAGKQGMKFFPLVFSLFMFVLTANLLGMFPYFFTITSQIIVTFAL AILVIGTVLVYGFYKHGFHFLNVFVPSGVPGILLPLVVSIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVASLGALGAVGVGGAVLPLIMTVALTGLEFLVAFLQAYVFAVLTCMY LNDAIHPGGH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel, playing a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of ATP synthase subunit a (atpB) in Rhizobium leguminosarum bv. trifolii?

ATP synthase subunit a (atpB) in Rhizobium leguminosarum bv. trifolii is a membrane-embedded component of the F₀ sector of the F₁F₀-ATP synthase complex. This protein typically consists of approximately 250 amino acids forming multiple transmembrane helices that create proton-conducting channels. The subunit plays a critical role in the rotary mechanism of ATP synthesis by facilitating proton translocation across the membrane, which drives the conformational changes in F₁ required for ATP synthesis.

The protein's structure is characterized by hydrophobic regions that anchor it within the bacterial membrane, with conserved residues that are essential for proton translocation. Based on homology with other bacterial ATP synthase systems, key residues in the atpB subunit are thought to interact directly with the rotating c-ring, coupling proton movement to the generation of rotational force .

How does the atpB sequence in Rhizobium leguminosarum bv. trifolii compare with other rhizobial species?

The atpB sequence in Rhizobium leguminosarum bv. trifolii shows significant homology with those from other rhizobial species, particularly with closely related strains like Sinorhizobium fredii. Comparative sequence analysis reveals several highly conserved regions, especially in the transmembrane domains and residues involved in proton translocation. For example, the Sinorhizobium fredii atpB protein consists of 250 amino acids with multiple transmembrane helices and conserved residues critical for function .

The sequence similarity typically ranges from 75-95% among rhizobial species, with the highest conservation in functional domains. Notable differences occur primarily in non-essential regions, reflecting evolutionary adaptations to specific host interactions. These variations may contribute to differences in ATP synthesis efficiency under the unique metabolic conditions encountered during symbiosis with specific legume hosts.

What regulatory factors influence atpB expression in free-living versus symbiotic states?

Expression of atpB in Rhizobium leguminosarum bv. trifolii is subject to complex regulatory mechanisms that differ between free-living and symbiotic states. In the free-living state, atpB expression is primarily regulated by energy demand and oxygen availability, with increased expression under aerobic conditions when ATP demand is high.

During symbiosis, atpB expression is influenced by microaerobic conditions inside root nodules and the unique carbon metabolic pathways activated during nitrogen fixation. The regulatory protein RosR has been shown to influence multiple cellular processes in R. leguminosarum bv. trifolii, including protein profiles and metabolism . While RosR has not been directly linked to atpB regulation, it affects many membrane proteins involved in transport systems, suggesting potential indirect effects on energy metabolism components like ATP synthase.

The transition from free-living to bacteroid state involves significant metabolic reprogramming, with oxygen limitation restricting the tricarboxylic acid (TCA) cycle . These metabolic shifts necessitate adjustments in ATP synthase activity and likely influence atpB expression patterns.

What are the optimal expression systems for producing recombinant Rhizobium leguminosarum bv. trifolii atpB protein?

The optimal expression system for recombinant R. leguminosarum bv. trifolii atpB protein is typically E. coli, which provides high yields and relatively straightforward genetic manipulation. Based on successful expression of related proteins, several specific E. coli strains have proven effective:

  • BL21(DE3) and its derivatives are commonly used for membrane protein expression due to their reduced protease activity and tight control of T7 RNA polymerase expression.

  • C41(DE3) and C43(DE3) strains, derived from BL21(DE3), are specifically engineered for membrane protein expression and can reduce toxicity issues often encountered with membrane proteins.

For expression vector selection, pET series vectors with His-tags (particularly N-terminal tags) have demonstrated good results with rhizobial proteins similar to atpB . The expression conditions typically require careful optimization of temperature (usually 16-25°C), IPTG concentration (0.1-0.5 mM), and induction time (4-16 hours) to balance protein yield with proper folding.

What purification strategies yield the highest purity and activity for recombinant atpB protein?

Purification of recombinant atpB protein requires specialized approaches due to its hydrophobic nature as a membrane protein. The most effective strategy employs:

  • Initial membrane preparation: Harvested cells are disrupted by sonication or French press, followed by differential centrifugation to isolate membrane fractions.

  • Solubilization: Membranes are solubilized using mild detergents (typically n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at 1-2%).

  • Affinity chromatography: His-tagged atpB protein can be purified using Ni-NTA resin under optimized binding and elution conditions (typically 20-250 mM imidazole gradient) .

  • Size exclusion chromatography: A final polishing step to remove aggregates and achieve >90% purity.

For highest activity retention, purification should be performed at 4°C with the continuous presence of detergent above its critical micelle concentration. Including phospholipids during purification can enhance stability and activity. Final purified protein is typically stored in buffer containing 20 mM Tris-HCl (pH 7.5-8.0), 150 mM NaCl, 0.05-0.1% detergent, and 10% glycerol .

How can researchers troubleshoot low yield or inactive atpB protein expression?

When encountering low yield or inactive atpB protein expression, researchers should systematically address several potential issues:

For low expression yield:

  • Optimize codon usage for E. coli by synthesizing a codon-optimized gene

  • Test alternative promoter systems (trc, tac, araBAD) if T7 system toxicity is suspected

  • Lower growth temperature (16-20°C) and reduce inducer concentration

  • Consider fusion partners that enhance solubility (MBP, SUMO)

  • Supplement growth media with membrane protein-specific additives (e.g., 1% glucose to reduce basal expression)

For inactive protein:

  • Verify proper membrane insertion using subcellular fractionation

  • Test alternative detergents for solubilization (CHAPS, digitonin, Triton X-100)

  • Include stabilizing agents during purification (glycerol, specific lipids)

  • Consider native purification approaches without denaturation steps

  • Evaluate different tag positions (C-terminal vs. N-terminal) that might interfere less with function

Analytical approaches for troubleshooting:

  • Western blotting to confirm expression and integrity

  • Mass spectrometry to verify sequence and post-translational modifications

  • Circular dichroism to assess secondary structure integrity

  • Limited proteolysis to evaluate folding quality

These methodological adjustments can significantly improve both yield and activity of this challenging membrane protein.

What biochemical assays can accurately measure atpB-associated ATP synthase activity?

Several biochemical assays can be employed to measure ATP synthase activity associated with the atpB subunit:

  • ATP synthesis assays: Reconstituting purified ATP synthase containing atpB into liposomes and measuring ATP production upon generation of a proton gradient (using acid-base transition or valinomycin-induced K+ diffusion potential). ATP production is typically quantified using luciferase-based luminescence assays.

  • ATP hydrolysis assays: Measuring the reverse reaction (ATP hydrolysis) using:

    • Coupled enzyme assays (pyruvate kinase/lactate dehydrogenase) monitoring NADH oxidation at 340 nm

    • Malachite green assay quantifying released inorganic phosphate

    • pH-sensitive dyes to detect proton production

  • Proton pumping assays: Using pH-sensitive fluorescent dyes (ACMA, pyranine) to monitor proton translocation across membranes in reconstituted proteoliposomes containing the ATP synthase complex.

  • Patch-clamp electrophysiology: For detailed analysis of proton channel properties of the a-subunit, allowing direct measurement of proton currents through single ATP synthase complexes.

For specific analysis of atpB function, researchers often employ inhibitor studies using oligomycin or venturicidin, which bind to the interface between the a-subunit and c-ring, blocking proton translocation. Comparing activity in wild-type versus site-directed mutants of atpB can provide insights into specific residues critical for function.

How can researchers effectively analyze atpB-protein interactions within the ATP synthase complex?

Analyzing atpB-protein interactions within the ATP synthase complex requires specialized approaches due to the hydrophobic nature of these interactions:

  • Chemical cross-linking coupled with mass spectrometry: Using membrane-permeable cross-linkers with various spacer arm lengths to capture transient interactions, followed by tandem mass spectrometry to identify cross-linked peptides.

  • Co-immunoprecipitation with specialized detergents: Employing mild detergents (digitonin, amphipol) that preserve protein-protein interactions during solubilization, followed by pull-down with antibodies against atpB or interacting partners.

  • Blue Native PAGE: Separating intact ATP synthase complexes under non-denaturing conditions to analyze complex integrity and subunit composition in wild-type versus atpB mutants.

  • Förster Resonance Energy Transfer (FRET): Introducing fluorescent protein tags or specific labels at strategic locations to monitor protein interactions in reconstituted systems or intact bacterial membranes.

  • Surface Plasmon Resonance (SPR) or Microscale Thermophoresis (MST): Quantifying binding affinities between atpB and other subunits using purified components in appropriate detergent environments.

  • Atomic Force Microscopy (AFM): Visualizing topography and surface properties of membrane complexes containing atpB, providing insights into complex assembly and organization .

These methods can be complemented by computational modeling approaches such as molecular dynamics simulations to predict interaction interfaces and conformational changes during the catalytic cycle.

What advanced imaging techniques are most informative for studying atpB localization and dynamics?

Advanced imaging techniques that provide valuable insights into atpB localization and dynamics include:

  • Super-resolution microscopy:

    • Stimulated Emission Depletion (STED) microscopy: Achieves resolution below the diffraction limit (~50 nm) to visualize the distribution of ATP synthase complexes in bacterial membranes

    • Photoactivated Localization Microscopy (PALM) and Stochastic Optical Reconstruction Microscopy (STORM): Enable single-molecule localization with 10-20 nm resolution to track individual ATP synthase complexes

  • Single-particle cryo-electron microscopy (cryo-EM): Provides near-atomic resolution structures of the entire ATP synthase complex, revealing the structural context of atpB within the assembled complex.

  • Electron tomography: Offers 3D visualization of ATP synthase distribution within the bacterial membrane with spatial resolution of 4-5 nm.

  • Atomic Force Microscopy (AFM): Beyond structural studies, AFM can be used in high-speed mode to capture conformational changes and rotational dynamics of ATP synthase complexes in membrane environments .

  • Fluorescence Recovery After Photobleaching (FRAP) and Fluorescence Correlation Spectroscopy (FCS): Provide information on the diffusion, mobility, and clustering of ATP synthase complexes in living bacterial cells.

  • Single-molecule Förster Resonance Energy Transfer (smFRET): Tracks conformational changes and rotational steps in individual ATP synthase molecules during catalysis.

For these techniques, fluorescent protein fusions or site-specific labeling strategies must be designed to minimize interference with atpB function while providing optimal signal for the chosen imaging modality.

How does atpB function contribute to the energy metabolism during the nitrogen fixation process?

The atpB function in R. leguminosarum bv. trifolii is crucial for energy metabolism during nitrogen fixation, as it forms part of the ATP synthase complex that generates ATP required for this energy-intensive process:

  • Microaerobic adaptation: Within nodules, bacteroids operate under extremely low oxygen conditions (10-40 nM) . The atpB subunit and the ATP synthase complex must function efficiently under these microaerobic conditions to support nitrogen fixation.

  • Supporting nitrogenase activity: Nitrogen fixation by nitrogenase requires 16 ATP molecules to reduce one N₂ molecule to two NH₃. The ATP synthase complex containing atpB is essential for generating this ATP supply. The energy workflow follows:

    • Dicarboxylates (malate, succinate) supplied by plant → TCA cycle → NADH/FADH₂ → Electron transport chain → Proton gradient → ATP synthesis via F₁F₀-ATP synthase (containing atpB)

  • Redox balance maintenance: Bacteroids must maintain redox balance under oxygen-limited conditions. The ATP synthase activity coordinated by atpB indirectly influences this balance by affecting electron flow through the respiratory chain. This is evidenced by the observation that carbon polymer synthesis and alanine secretion by bacteroids facilitate redox balance in microaerobic nodules .

  • Metabolic adaptation: Restricted oxygen supply limits the decarboxylating arm of the TCA cycle , which necessitates adaptations in ATP synthesis efficiency to ensure sufficient energy for nitrogen fixation despite metabolic constraints.

The atpB subunit's specific structure in R. leguminosarum bv. trifolii likely represents an evolutionary adaptation to these unique bioenergetic challenges of symbiotic nitrogen fixation.

What evidence suggests atpB expression or function is regulated differently during symbiosis versus free-living conditions?

Several lines of evidence indicate differential regulation of atpB expression and function between symbiotic and free-living states:

These observations collectively suggest that atpB expression and function are likely fine-tuned to meet the specific bioenergetic demands of the symbiotic lifestyle.

How might mutations in atpB affect the establishment of effective symbiosis with clover plants?

Mutations in atpB could significantly impact symbiotic effectiveness through several mechanisms:

While no direct studies of atpB mutations in R. leguminosarum bv. trifolii symbiosis were present in the search results, research on RosR mutants showed altered cell surface topography and membrane integrity, resulting in impaired symbiotic properties with clover plants . Since energy metabolism and membrane properties are interconnected, atpB mutations would likely produce similarly detrimental effects.

How does the atpB subunit from Rhizobium leguminosarum bv. trifolii compare with ATP synthase components from other bacterial species?

The atpB subunit from R. leguminosarum bv. trifolii shares structural and functional characteristics with ATP synthase subunit a from other bacteria, but also exhibits unique features that reflect its evolutionary adaptation to symbiotic lifestyle:

The specialized metabolic environment of nitrogen-fixing bacteroids, characterized by oxygen limitation and reliance on plant-supplied dicarboxylates , has likely driven unique evolutionary adaptations in the rhizobial atpB subunit compared to free-living bacterial species.

What insights do cross-species structural studies provide about conserved functional domains in atpB?

Cross-species structural studies of ATP synthase subunit a (atpB) reveal several conserved functional domains that are critical for ATP synthase function:

  • Transmembrane helices: All bacterial atpB proteins contain multiple transmembrane helices (typically 5-6) that anchor the protein in the membrane. The arrangement of these helices creates the half-channels necessary for proton translocation.

  • Critical residue conservation: Several absolutely conserved residues are present across bacterial species:

    • A key arginine residue (typically Arg210 in E. coli numbering) essential for proton translocation

    • Polar residues that form the proton pathway

    • Interface residues that interact with the c-ring rotor

  • Species-specific variations: Structural studies reveal adaptations in non-conserved regions that likely reflect:

    • Different lipid environments

    • Varying pH optima

    • Different bioenergetic demands

  • Functional implications: Comparative structural biology suggests that while the basic mechanism of proton translocation is conserved, subtle structural differences can significantly affect:

    • ATP synthesis efficiency

    • Proton leakage rates

    • Optimal operating conditions

Although the search results don't include specific structural data for R. leguminosarum bv. trifolii atpB, the amino acid sequence available for the related Sinorhizobium fredii atpB (250 amino acids) aligns with the expected length and composition for bacterial ATP synthase subunit a proteins.

The predicted structure would include multiple transmembrane helices with conserved functional residues positioned to form the proton translocation pathway. The specific adaptations in R. leguminosarum bv. trifolii atpB would reflect its specialization for function during symbiotic nitrogen fixation under the unique conditions present in root nodules.

What evolutionary adaptations in atpB might be specific to nitrogen-fixing symbiotic bacteria?

Nitrogen-fixing symbiotic bacteria likely exhibit several evolutionary adaptations in their atpB subunits that enhance ATP synthesis efficiency under the unique conditions of symbiosis:

  • Microaerobic optimization: Root nodules maintain extremely low oxygen concentrations (10-40 nM) to protect oxygen-sensitive nitrogenase. The atpB subunit in rhizobia has likely evolved to optimize proton translocation under these microaerobic conditions, potentially showing:

    • Modified proton-binding affinities

    • Altered interactions with the c-ring to maintain efficiency at low proton-motive force

    • Structural adaptations that minimize proton leakage

  • Metabolic integration: Symbiotic bacteroids primarily utilize dicarboxylates from the host plant, which induces a higher NADH/NAD+ ratio than sugar metabolism . The atpB subunit may have adapted to function optimally under these unique metabolic conditions, with:

    • Enhanced coupling efficiency to maximize ATP yield from limited oxygen

    • Regulatory modifications that coordinate ATP synthase activity with nitrogen fixation demands

  • Stress resistance adaptations: Bacteroids face various stresses within nodules, including oxidative stress despite low oxygen levels. The atpB sequence may include modifications that enhance stability under these conditions.

  • Host-specific adaptations: Different rhizobial species nodulate specific legume hosts. Fine-tuning of atpB function may contribute to host specificity by matching energy generation capacity to the particular metabolic environment provided by specific host plants.

  • Integration with symbiosis-specific regulation: The regulatory mechanisms controlling atpB expression likely evolved to respond to plant-derived signals and symbiosis-specific transcription factors, such as the RosR protein that affects numerous cellular processes in R. leguminosarum bv. trifolii .

These adaptations reflect the specialized energetic challenges of symbiotic nitrogen fixation, where ATP synthase must function efficiently to power nitrogen fixation while coordinating with the metabolic constraints imposed by microaerobic conditions and plant-controlled carbon supply.

How might site-directed mutagenesis of atpB advance understanding of ATP synthase function in nitrogen-fixing bacteria?

Site-directed mutagenesis of atpB in R. leguminosarum bv. trifolii offers powerful opportunities to advance understanding of ATP synthase function in nitrogen-fixing bacteria:

  • Proton pathway mapping: Systematic mutagenesis of predicted channel-forming residues could:

    • Define the precise proton translocation pathway

    • Identify residues that determine proton specificity

    • Reveal adaptations specific to microaerobic environments of nodules

  • c-ring interaction analysis: Mutations at the predicted interface between atpB and the c-ring could:

    • Clarify the molecular basis of rotor-stator coupling

    • Identify determinants of rotational efficiency under low oxygen conditions

    • Reveal specializations for functioning with the high NADH/NAD+ ratio characteristic of dicarboxylate metabolism

  • Symbiosis-specific function investigation: Creating mutants with altered ATP synthesis efficiency would allow researchers to:

    • Determine the minimum ATP synthesis capacity required for effective nitrogen fixation

    • Assess the relationship between ATP availability and ammonia export to the plant

    • Understand how energy limitation affects bacteroid development and function

  • Regulatory interaction sites: Mutagenesis of potential regulatory sites could:

    • Identify regions involved in adapting ATP synthase activity to symbiotic conditions

    • Reveal potential interaction sites with symbiosis-specific regulatory proteins

    • Uncover mechanisms coordinating ATP synthesis with nitrogen fixation

A systematic mutagenesis approach would ideally include:

  • Conserved residues predicted to be essential for function

  • Residues unique to rhizobial atpB compared to non-symbiotic bacteria

  • Residues at interfaces with other ATP synthase subunits

  • Potential regulatory sites or post-translational modification targets

Each mutant would be assessed for effects on ATP synthesis, growth, and critically, symbiotic performance with clover plants, similar to approaches used to study the effects of RosR mutations on R. leguminosarum bv. trifolii symbiotic properties .

What methodologies combine structural and functional analyses to elucidate atpB mechanism during symbiosis?

Advanced integrated methodologies that combine structural and functional analyses can provide comprehensive insights into atpB mechanism during symbiosis:

  • In situ cryo-electron tomography:

    • Visualize ATP synthase complexes directly within bacteroid membranes isolated from nodules

    • Map the distribution and organization of ATP synthase complexes in relation to other symbiosis-relevant membrane proteins

    • Compare with free-living bacteria to identify symbiosis-specific structural arrangements

  • Structure-guided mutagenesis coupled with symbiotic phenotyping:

    • Use homology models or determined structures to design targeted mutations

    • Assess effects on both ATP synthesis biochemistry and symbiotic nitrogen fixation

    • Correlate structural features with symbiotic performance metrics

  • Time-resolved analyses during symbiosis development:

    • Sample nodules at different developmental stages

    • Combine proteomics, microscopy, and biochemical assays to track changes in ATP synthase composition, organization, and activity

    • Correlate with metabolic shifts during bacteroid differentiation

  • Metabolic flux analysis with atpB variants:

    • Introduce atpB mutations that alter ATP synthesis efficiency

    • Employ 13C metabolic flux analysis similar to approaches used for Azorhizobium caulinodans

    • Map consequences for carbon flow, nitrogen fixation, and ammonia export

  • Multi-scale modeling approaches:

    • Integrate structural data into molecular dynamics simulations of atpB function

    • Feed biophysical parameters into metabolic models of bacteroid metabolism

    • Connect to whole-nodule physiological models of nitrogen fixation

  • Advanced imaging of ATP dynamics:

    • Deploy genetically encoded ATP sensors in bacteroids

    • Use microscopy to visualize ATP distribution in relation to atpB location

    • Correlate with nitrogenase activity and nitrogen export

  • Cross-species comparative analyses:

    • Compare atpB structure, function, and regulation across diverse rhizobial species

    • Correlate differences with host specificity and symbiotic efficiency

    • Identify conserved versus variable features to distinguish core functional elements from adaptations

These integrated approaches can reveal how the molecular mechanism of atpB-containing ATP synthase is optimized for the unique bioenergetic challenges of symbiotic nitrogen fixation.

How could engineered atpB variants be used to enhance symbiotic nitrogen fixation efficiency?

Engineered atpB variants offer promising avenues for enhancing symbiotic nitrogen fixation efficiency through several strategic approaches:

  • Enhanced energy conversion efficiency:

    • Engineer atpB mutations that optimize proton translocation under microaerobic conditions

    • Reduce proton leakage to maximize ATP yield per oxygen molecule consumed

    • Fine-tune c-ring interaction to maintain efficiency at the low proton motive force typical in nodules

  • Stress resistance improvement:

    • Develop atpB variants with enhanced stability under oxidative stress conditions

    • Engineer pH-tolerant variants that maintain function across fluctuating nodule pH

    • Increase thermostability to improve performance under environmental stress

  • Host-optimized variants:

    • Create atpB variants specifically optimized for the metabolic environment provided by particular host plants

    • Fine-tune ATP synthesis capacity to match the carbon supply patterns of different legume crops

    • Develop variants that coordinate optimally with host-specific oxygen regulation

  • Metabolic integration enhancement:

    • Design atpB variants that improve coordination between ATP synthesis and nitrogen fixation

    • Develop variants that balance the NADH/NAD+ ratio when metabolizing dicarboxylates

    • Engineer regulatory modifications that optimize energy allocation between nitrogen fixation and cellular maintenance

  • Synthetic biology approaches:

    • Create synthetic regulatory circuits linking atpB expression to symbiosis-specific signals

    • Develop atpB variants with modified regulatory regions that enhance expression at critical symbiotic stages

    • Integrate atpB improvements with other modifications in carbon metabolism to create holistically optimized strains

Implementation of such engineering would require:

  • High-throughput screening systems to evaluate ATP synthesis efficiency

  • Plant-based assays to assess symbiotic performance

  • Metabolic modeling to predict system-wide effects of atpB modifications

  • Field testing under agricultural conditions

These approaches align with ongoing efforts to engineer novel plant-microbe interactions for sustainable agriculture , with atpB engineering representing a targeted strategy to address the fundamental bioenergetic challenges of symbiotic nitrogen fixation.

What are the main technical challenges in studying recombinant atpB function and how can they be overcome?

Studying recombinant atpB function presents several technical challenges with corresponding solutions:

  • Membrane protein expression barriers:

    • Challenge: Low expression levels and toxicity to host cells

    • Solutions:

      • Use specialized E. coli strains (C41/C43) designed for membrane protein expression

      • Employ fusion partners (MBP, SUMO) that enhance folding and reduce toxicity

      • Develop tunable expression systems with precise control over induction levels

      • Consider cell-free protein synthesis systems for toxic proteins

  • Proper membrane insertion and folding:

    • Challenge: Ensuring correct topology and native-like folding

    • Solutions:

      • Optimize lipid environment during expression and purification

      • Include chaperones or folding modulators during expression

      • Monitor folding using conformation-sensitive assays

      • Validate structure using limited proteolysis and spectroscopic techniques

  • Functional reconstitution difficulties:

    • Challenge: Maintaining activity after extraction from membrane

    • Solutions:

      • Screen multiple detergents to identify optimal solubilization conditions

      • Reconstitute into nanodiscs or liposomes with defined lipid composition

      • Include essential lipids identified from the native membrane

      • Develop activity assays that can be performed in detergent-solubilized state

  • Integration into complete ATP synthase complex:

    • Challenge: atpB functions as part of a multi-subunit complex

    • Solutions:

      • Co-express with other ATP synthase subunits

      • Reconstitute with purified partner subunits

      • Develop hybrid systems combining recombinant atpB with native complex components

      • Use partial complexes to study specific interactions

  • Assessing function under symbiosis-relevant conditions:

    • Challenge: Mimicking the microaerobic, specialised metabolic environment of nodules

    • Solutions:

      • Develop microaerobic assay systems with precise oxygen control

      • Include metabolites present in nodules (dicarboxylates, etc.)

      • Consider whole-cell approaches in rhizobial backgrounds

      • Design in vitro systems that replicate the pH and ion composition of symbiosomes

By addressing these challenges with the suggested solutions, researchers can obtain more reliable and physiologically relevant data on recombinant atpB function in the context of symbiotic nitrogen fixation.

How can researchers effectively measure ATP synthase activity in bacteroids within nodules?

Measuring ATP synthase activity in bacteroids within nodules presents unique challenges requiring specialized approaches:

  • In situ ATP synthesis measurements:

    • Approach: Infect plants with rhizobia containing genetically encoded ATP sensors

    • Technique: Use two-photon microscopy to visualize ATP levels within intact nodules

    • Analysis: Correlate ATP dynamics with bacteroid location and developmental stage

    • Advantage: Provides spatial information about ATP synthesis activity

  • Isolated bacteroid studies:

    • Approach: Carefully isolate bacteroids from nodules while maintaining membrane integrity

    • Technique: Measure ATP synthesis by luciferase assay in freshly isolated bacteroids

    • Controls: Include inhibitors (oligomycin, DCCD) to confirm ATP synthase contribution

    • Variables: Test different substrates (malate, succinate) to assess metabolic coupling

  • Membrane potential measurements:

    • Approach: Use voltage-sensitive fluorescent dyes with isolated bacteroids

    • Technique: Monitor membrane potential changes in response to substrates and inhibitors

    • Application: Indirectly assess proton-motive force generation that drives ATP synthesis

    • Advantage: Provides insights into the bioenergetic state of bacteroids

  • Oxygen consumption analysis:

    • Approach: Use high-sensitivity oxygen electrodes with isolated bacteroids

    • Technique: Measure respiratory rates under different conditions

    • Analysis: Calculate P/O ratios (ATP synthesized per oxygen consumed)

    • Relevance: Essential for understanding energy conservation efficiency in the microaerobic nodule environment

  • Proteomics and post-translational modification analysis:

    • Approach: Analyze ATP synthase subunits isolated directly from bacteroids

    • Technique: Use mass spectrometry to identify post-translational modifications

    • Application: Determine regulatory modifications affecting ATP synthase activity in symbiosis

    • Advantage: Reveals symbiosis-specific regulatory mechanisms

  • Transcription-translation coupling:

    • Approach: Measure both atpB expression and ATP synthase activity in parallel

    • Technique: Combine RT-qPCR with biochemical activity assays

    • Analysis: Determine correlation between expression and activity during nodule development

    • Insight: Reveals regulatory mechanisms operating at transcriptional versus post-translational levels

What approaches can address the challenge of studying protein-protein interactions involving membrane-embedded atpB?

Studying protein-protein interactions involving membrane-embedded atpB requires specialized approaches that accommodate the hydrophobic nature of these interactions:

  • Membrane-specific crosslinking strategies:

    • Technique: Employ lipid-permeable, photoactivatable crosslinkers with variable spacer lengths

    • Analysis: Identify crosslinked partners using mass spectrometry

    • Advantage: Captures transient interactions within native membrane environment

    • Challenge solved: Preserves interactions that would be disrupted by detergent solubilization

  • Split reporter systems adapted for membrane proteins:

    • Approach: Fuse split GFP, split luciferase, or DHFR fragments to atpB and potential partners

    • Detection: Monitor reporter reconstitution as evidence of interaction

    • Application: Can be used in living cells during symbiotic conditions

    • Advantage: Enables dynamic study of interaction networks during bacteroid development

  • Styrene-maleic acid lipid particles (SMALPs) extraction:

    • Technique: Extract membrane protein complexes with native lipid environment intact

    • Advantage: Maintains native lipid-protein interactions absent in detergent systems

    • Analysis: Compatible with size exclusion chromatography, mass spectrometry, and structural studies

    • Challenge solved: Avoids detergent artifacts that can disrupt weak membrane protein interactions

  • Surface plasmon resonance with nanodiscs:

    • Approach: Reconstitute atpB into nanodiscs for surface immobilization

    • Measurement: Quantify binding kinetics with soluble domains of interaction partners

    • Advantage: Provides quantitative binding parameters in membrane-like environment

    • Application: Can screen multiple potential interaction partners efficiently

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Technique: Monitor deuterium incorporation at protein interaction interfaces

    • Analysis: Identify regions with altered solvent accessibility upon complex formation

    • Advantage: Can map interaction interfaces with peptide-level resolution

    • Challenge solved: Provides structural information without requiring protein crystallization

  • Atomic force microscopy (AFM) for membrane complexes:

    • Approach: Visualize ATP synthase complexes in membrane patches

    • Analysis: Determine topography and organization of complexes

    • Advanced application: Use AFM with functionalized tips to probe specific interactions

    • Advantage: Provides structural context for protein interactions in the membrane

  • Computational approaches:

    • Technique: Molecular dynamics simulations of atpB in membrane environment

    • Analysis: Predict stable interaction interfaces and conformational changes

    • Integration: Guide experimental design and help interpret interaction data

    • Challenge solved: Provides atomistic insights into interactions difficult to capture experimentally

These complementary approaches can collectively overcome the significant challenges in studying membrane protein interactions, providing a comprehensive understanding of atpB's interaction network within the ATP synthase complex and potentially with other proteins during symbiosis.

How should researchers interpret apparently conflicting results from different ATP synthase activity assays?

When faced with conflicting results from different ATP synthase activity assays, researchers should implement a systematic interpretation framework:

By systematically addressing these aspects, researchers can resolve apparent conflicts and develop a more nuanced understanding of atpB function in different contexts.

What statistical approaches are most appropriate for analyzing atpB mutation effects on symbiotic phenotypes?

Analyzing the effects of atpB mutations on symbiotic phenotypes requires careful statistical approaches to capture the complex, multilevel nature of the symbiotic system:

These statistical approaches should be combined with appropriate experimental designs, such as randomized complete block designs that control for environmental variation in greenhouse or growth chamber studies.

How can researchers differentiate direct effects of atpB mutations from indirect metabolic consequences?

Differentiating direct effects of atpB mutations from indirect metabolic consequences requires strategic experimental design and analytical approaches:

  • Strategic mutation design:

    • Approach: Create a panel of mutations with predicted effects ranging from subtle to severe

    • Analysis: Look for correlations between the predicted impact on specific ATP synthase functions and observed phenotypes

    • Advantage: Mutations affecting only certain aspects of atpB function can help isolate direct effects

    • Example: Compare proton channel mutations versus c-ring interface mutations versus regulatory site mutations

  • Rapid phenotypic assessment:

    • Approach: Measure immediate biophysical parameters before metabolic adaptation can occur

    • Techniques: Membrane potential measurements, ATP synthesis rates in isolated membranes, proton leakage assays

    • Timing: Compare immediate effects (minutes to hours) versus long-term effects (days)

    • Insight: Direct effects should manifest immediately, while indirect effects emerge over time as metabolism adapts

  • Metabolic flux analysis:

    • Approach: Use 13C-labeled substrates to trace carbon flow through central metabolism

    • Technique: Similar to the metabolic flux analysis used for Azorhizobium caulinodans

    • Analysis: Identify metabolic pathway adjustments that occur in response to ATP synthase dysfunction

    • Distinction: Differentiate primary effects on bioenergetics from secondary metabolic rerouting

  • Multi-omics integration:

    • Approach: Combine transcriptomics, proteomics, and metabolomics data from the same samples

    • Analysis: Identify temporal sequences of molecular changes following atpB mutation

    • Technique: Network analysis to distinguish primary from secondary responses

    • Advantage: Reveals causality chains from atpB mutation to ultimate phenotypic effects

  • Suppressor mutation analysis:

    • Approach: Identify second-site mutations that restore symbiotic function in atpB mutants

    • Analysis: Classify suppressors as direct (affecting ATP synthase) versus indirect (affecting metabolic pathways)

    • Insight: Suppressors often reveal compensatory pathways and distinguish primary from secondary effects

  • Conditional expression systems:

    • Approach: Create strains where wild-type or mutant atpB expression can be induced or repressed

    • Experiment: Induce expression at different stages of symbiosis

    • Analysis: Determine when atpB function is directly required for symbiotic processes

    • Advantage: Temporal control helps separate direct effects from adaptive responses

  • Complementation with heterologous ATP synthase components:

    • Approach: Replace R. leguminosarum atpB with orthologs from related species

    • Analysis: Determine which features of atpB are specifically required for symbiotic function

    • Insight: Function-specific complementation helps identify which aspects of atpB are directly involved in symbiosis

  • Correlation with structural data:

    • Approach: Map mutations onto structural models of ATP synthase

    • Analysis: Correlate phenotypic effects with structural location and predicted mechanistic impact

    • Technique: Molecular dynamics simulations to predict specific functional consequences

    • Advantage: Strong structure-function correlations suggest direct rather than indirect effects

These approaches collectively enable researchers to build a causality map from primary bioenergetic effects of atpB mutations to secondary metabolic adaptations and ultimately to symbiotic phenotypes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.