Recombinant Rhizobium leguminosarum bv. trifolii ATP synthase subunit b/b' (atpG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF2; atpG; Rleg2_0514; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-207
Protein Length
full length protein
Species
Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Target Names
atpF2
Target Protein Sequence
MFFVTPAYAEEAPAAATGTDAHAAPAAGEVHTETGVAEGEHARGPFPPFDSTTYASQLLW LVITFSVFYLLMQKVIAPRIGAILDQRHTRLSQDLEEAGRLKAEADAAVQTYEGELAAAR AKSNAIGAAARDAAKLKAEEDRRAVEASLSEKIKAAEVRIADIKAKAFADVGTIAEETAA AVVEQLIGGTAAQADVAAAVAAAKKEA
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extra-membraneous) and the F(0) membrane proton channel, connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. The b'-subunit, a component of the F(0) channel and part of the peripheral stalk, links F(1) to F(0). It's a diverged and duplicated form of the b-subunit found in plants and photosynthetic bacteria.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the molecular structure of the ATP synthase subunit b/b' (atpG) in Rhizobium leguminosarum bv. trifolii and how does it function within the ATP synthase complex?

The ATP synthase subunit b/b' (atpG) in R. leguminosarum bv. trifolii is a critical structural component of the F1F0-ATP synthase complex. This protein forms part of the peripheral stalk (stator) that connects the membrane-embedded F0 domain to the catalytic F1 domain. Structurally, atpG typically contains:

  • An N-terminal hydrophobic domain that anchors to the membrane

  • A central dimerization domain that forms a coiled-coil structure with a second b subunit

  • A C-terminal domain that interacts with the δ subunit of the F1 portion

The primary function of atpG is to prevent futile rotation of the F1 domain during ATP synthesis by providing a stationary connection between the F0 and F1 domains. This stabilization is essential for efficient energy transduction during oxidative phosphorylation. Unlike catalytic subunits, atpG does not directly participate in ATP synthesis but provides the structural framework necessary for the rotary mechanism to function properly.

For functional studies, researchers should consider that alterations to either terminus can significantly affect the protein's ability to integrate into the ATP synthase complex and support energy production.

How can I design primers for cloning the atpG gene from Rhizobium leguminosarum bv. trifolii?

When designing primers for cloning the atpG gene from R. leguminosarum bv. trifolii, consider these research-focused strategies:

  • Sequence analysis approach:

    • Identify conserved regions by aligning atpG sequences from related rhizobial species

    • Include 18-25 nucleotides of exact match to the target sequence

    • Maintain a GC content of 40-60% and avoid secondary structures

    • Add appropriate restriction sites with 3-6 nucleotide overhangs at the 5' end

  • Recommended primer design parameters:

ParameterForward PrimerReverse Primer
Target regionStart codon and upstreamStop codon and downstream
Added featuresRestriction site, start codonRestriction site, stop codon
Tag optionsHis6, FLAG, or no tagHis6, Strep, or no tag
GC clamp1-2 G/C at 3' end1-2 G/C at 3' end
Tm58-62°C58-62°C
  • Expression considerations:

    • Add sequences for in-frame fusion with affinity tags

    • Consider codon optimization if expressing in E. coli

    • Include ribosome binding site if designing for direct expression

Similar cloning strategies have been successfully applied for other R. leguminosarum proteins, such as LpxE, where expression in E. coli behind the T7 lac promoter yielded functional protein . Researchers successfully used carefully designed primers with restriction sites (SacI and XhoI) and appropriate clamps to create functional expression constructs .

What expression systems are most effective for recombinant production of R. leguminosarum bv. trifolii atpG?

Based on research with similar proteins in R. leguminosarum, the following expression systems have proven effective for recombinant production of membrane-associated proteins like atpG:

  • E. coli-based expression systems:

    • BL21(DE3) with pET vectors (particularly pET-28a) under T7 promoter control offers high yield

    • C41/C43 strains (designed for membrane proteins) may improve solubility

    • Growth at lower temperatures (16-20°C) after induction significantly improves folding

    • Addition of 0.5-1% glucose helps reduce basal expression before induction

  • Rhizobial expression systems:

    • Homologous expression in R. leguminosarum using broad-host-range vectors

    • Selection using tetracycline resistance (12.5 μg/ml) as documented for similar proteins

    • Use of inducible promoters like tac or rhamnose-inducible systems

    • R. etli CE3 has been successfully used as an expression host for R. leguminosarum proteins

Comparative analysis of expression conditions:

Expression SystemProtein YieldSolubilityNative StructurePurification Ease
E. coli BL21(DE3)HighModerateModerateHigh
E. coli C41/C43ModerateHighModerateHigh
R. leguminosarumLowHighHighModerate
R. etli CE3Low-ModerateHighHighModerate

For membrane-associated proteins like atpG, research shows that tri-parental mating is an effective method for introducing expression plasmids into rhizobial hosts , which may provide more native-like membrane environments for proper folding and function.

What are the major challenges in purifying functional atpG and how can they be overcome?

Purification of functional atpG presents several specific challenges due to its membrane association and structural role. Based on experimental approaches used with similar proteins in Rhizobium species, researchers should consider:

  • Solubilization challenges:

    • Challenge: atpG contains hydrophobic membrane-anchoring domains that promote aggregation

    • Solution: Screen multiple detergents (DDM, LDAO, Triton X-100 at 0.5-1%)

    • Methodology: Perform gentle lysis using lysozyme (1 mg/ml) and EDTA (2 mM) followed by freeze-thaw cycles, as documented for other membrane proteins in Rhizobium

  • Maintaining protein stability:

    • Challenge: Loss of structural integrity during purification

    • Solution: Include glycerol (10-20%), appropriate detergent, and phospholipids

    • Methodology: Prepare membrane fractions via ultracentrifugation (100,000 × g) before detergent extraction

  • Preserving functional interactions:

    • Challenge: Isolating atpG while maintaining its ability to interact with partner subunits

    • Solution: Consider co-expression with interacting partners or mild purification conditions

    • Methodology: Test functional reconstitution using complementation assays

  • Purification strategy recommendations:

Purification StageRecommended ApproachCritical ParametersQuality Control
Cell lysisLysozyme/EDTA with freeze-thaw1 mg/ml lysozyme, 2 mM EDTA Microscopy for cell rupture
Membrane isolationDifferential centrifugation100,000 × g, 1 hourMembrane marker proteins
SolubilizationDetergent screening0.5-1% detergent, 4°CSolubility analysis by SDS-PAGE
Affinity purificationIMAC (His-tagged protein)Optimize imidazole gradientSDS-PAGE, Western blot
PolishingSize exclusion chromatographyDetergent above CMCPurity, oligomeric state

Research protocols for membrane proteins in R. leguminosarum demonstrate that careful membrane fraction preparation followed by appropriate detergent extraction is critical for maintaining protein function .

How can I establish an ATP synthase activity assay using purified recombinant atpG?

Since atpG is a structural rather than catalytic subunit, direct enzyme activity assays are not applicable. Instead, researchers should use functional reconstitution approaches to assess its contribution to ATP synthase activity:

  • Reconstitution assay design:

    • Purify individual ATP synthase components (or use commercial F1 preparations)

    • Prepare atpG-depleted membrane vesicles from R. leguminosarum

    • Reconstitute with purified recombinant atpG

    • Measure ATP synthesis upon energization

  • Protocol outline:

    • Prepare proteoliposomes containing ATP synthase components minus atpG

    • Add varying concentrations of purified recombinant atpG

    • Create proton gradient (acid-base transition or respiratory substrates)

    • Measure ATP production using luciferase assay

  • Control experiments:

    • Negative control: Reconstitution without atpG

    • Positive control: Reconstitution with native ATP synthase complex

    • Specificity control: Addition of ATP synthase inhibitors (oligomycin, DCCD)

    • Validation control: Reconstitution with known mutant variants of atpG

  • Data interpretation parameters:

ParameterMeasurement MethodExpected OutcomeTroubleshooting
ATP synthesis rateLuciferase assayIncreased with functional atpGCheck proton gradient formation
Proton translocationpH-sensitive dyesCoupled to ATP synthesisVerify membrane integrity
Complex assemblyBN-PAGEHigh MW complex formationAssess protein-protein interactions
Concentration dependenceTitration curveSaturation kineticsCheck protein stability

Similar reconstitution approaches have been successfully applied with other membrane proteins from R. leguminosarum, where careful membrane preparation and protein incorporation were critical for preserving functionality .

What methods can distinguish between native and recombinant atpG in experimental settings?

Distinguishing between native and recombinant atpG is essential for functional complementation studies and protein interaction analyses. Based on experimental approaches in Rhizobium research, consider these methodologies:

  • Epitope tagging strategies:

    • Incorporate His6, FLAG, or HA tags at either terminus of recombinant atpG

    • Use tag-specific antibodies for Western blot detection

    • Verification: Compare function of tagged vs. untagged versions to ensure tag doesn't interfere with activity

  • Mass spectrometry approaches:

    • Introduce unique peptide sequences that don't affect function

    • Analyze tryptic digests to identify tag-specific or mutation-specific peptides

    • Benefit: Provides absolute identification without antibodies

  • Genetic approaches for in vivo studies:

    • Express in atpG deletion backgrounds

    • Use expression vectors with antibiotic resistance markers (tetracycline at 12.5 μg/ml) for selection

    • Utilize promoters responsive to specific inducers not affecting native atpG

  • Comparison of discrimination methods:

MethodSensitivitySpecificityTechnical ComplexityFunctional Impact
His-tag detectionHighVery highLowMinimal to moderate
FLAG/HA tag detectionHighVery highLowMinimal
Mass spectrometryVery highVery highHighNone
RT-PCR with specific primersHighHighModerateNone
Genetic complementationModerateHighHighPotential expression differences

When working with R. leguminosarum, researchers have successfully employed tagged recombinant proteins for functional studies, using techniques like tri-parental mating for introducing expression constructs . The complementation approach has been particularly valuable, using plasmid-borne genes to restore function in mutant strains .

How does atpG expression change during the establishment of symbiosis with legume hosts?

The expression of atpG in R. leguminosarum bv. trifolii undergoes dynamic regulation during symbiotic development with clover hosts. This regulation reflects changing energy demands throughout the symbiotic process:

  • Expression pattern during symbiotic stages:

    • Free-living cells: Baseline expression levels regulated by oxygen and carbon source

    • Rhizosphere colonization: Slight downregulation upon exposure to plant flavonoids

    • Infection thread formation: Transient expression changes during bacterial invasion

    • Bacteroid differentiation: Significant upregulation to support energy demands

    • Mature nitrogen-fixing bacteroids: Sustained high expression to power nitrogenase activity

  • Regulatory mechanisms:

    • Oxygen-sensing systems coordinate ATP synthase expression with microaerobic conditions in nodules

    • Carbon source availability (particularly dicarboxylates in nodules) modulates expression

    • Integration with nitrogen fixation regulatory networks (FixK, NifA)

  • Experimental evidence from related proteins:
    Studies on other membrane proteins in R. leguminosarum have shown that regulatory proteins like RosR significantly affect expression profiles of multiple transport systems and membrane-associated proteins during symbiotic development . Protein profile analysis between wild-type and mutant strains has revealed distinct differences in membrane proteins during symbiotic stages .

  • Expression comparison across symbiotic stages:

Symbiotic StageatpG Expression LevelEnergy DemandKey Regulatory Factors
Free-livingBaselineModerateOxygen, carbon availability
Rhizosphere colonizationSlight decreaseLow-moderatePlant signals, flavonoids
Infection threadVariableModeratePlant-derived compounds
Early bacteroidIncreasingHighMicroaerobic conditions
Mature bacteroidSignificantly elevatedVery highNitrogenase activity, carbon supply

Understanding these expression changes provides insights into the energetic adaptations of R. leguminosarum during the transition from free-living to symbiotic lifestyles.

What is the relationship between ATP synthase function and nitrogen fixation efficiency?

The ATP synthase complex, including the atpG subunit, plays a pivotal role in determining nitrogen fixation efficiency in R. leguminosarum bv. trifolii. This relationship centers on meeting the substantial energy demands of the nitrogenase enzyme:

  • Energetic requirements of nitrogen fixation:

    • Nitrogenase requires approximately 16 ATP molecules to reduce one N₂ molecule

    • Additional ATP is needed for nutrient uptake and cellular maintenance

    • Total energy budget for effective nitrogen fixation can exceed 30 ATP per N₂ reduced

  • ATP synthase contribution to the energy budget:

    • Primary ATP producer in bacteroids via oxidative phosphorylation

    • Must function efficiently under microaerobic conditions in nodules

    • Structural integrity (dependent on atpG) is essential for optimal proton translocation and ATP production

  • Regulatory coordination:

    • Shared regulatory elements between ATP synthase and nitrogen fixation genes

    • Carbon flux from the plant influences both energy production and nitrogen fixation

    • Oxygen concentration serves as a common signal for both pathways

  • Evidence from R. leguminosarum mutants:
    Research on R. leguminosarum has shown that mutations affecting membrane proteins and transport systems can significantly impair symbiotic performance . The proper assembly and function of membrane complexes, including ATP synthase, directly impacts the bacterium's ability to differentiate into effective nitrogen-fixing bacteroids .

  • Metabolic balance in bacteroids:

ProcessCarbon AllocationATP RelationshipImpact on Nitrogen Fixation
Respiration/ATP synthesis60-70%ProductionDirect positive correlation
Nitrogenase activity15-20%ConsumptionDependent on ATP availability
Transport processes5-10%ConsumptionEssential for nutrient exchange
Cellular maintenance10-15%ConsumptionRequired for bacteroid viability

This intricate relationship makes ATP synthase function a critical determinant of symbiotic efficiency and agricultural productivity of clover and other legume crops associated with R. leguminosarum bv. trifolii.

How can site-directed mutagenesis of atpG be used to investigate structure-function relationships?

Site-directed mutagenesis of atpG provides a powerful approach to investigate structure-function relationships in the ATP synthase complex of R. leguminosarum bv. trifolii. This experimental strategy allows researchers to dissect specific contributions of different protein domains:

  • Key domains for mutagenesis targeting:

    • N-terminal membrane-anchoring domain: Analyze membrane integration and stability

    • Dimerization domain: Investigate coiled-coil formation and stator assembly

    • C-terminal domain: Explore interactions with the δ subunit and F1 attachment

  • Mutagenesis approach:

    • PCR-based site-directed mutagenesis using overlapping primers

    • Gibson Assembly for multiple mutations or domain swaps

    • Construct verification by sequencing before functional testing

  • Functional analysis methodology:

    • Express mutants in complementation systems (atpG-deficient backgrounds)

    • Analyze ATP synthesis rates in membrane preparations

    • Assess complex assembly using blue native PAGE

    • Examine protein-protein interactions via crosslinking or pull-down assays

  • Critical residues and their predicted effects:

DomainTarget ResiduesMutation TypeExpected EffectAnalysis Method
Membrane anchorHydrophobic residuesAla substitutionReduced membrane associationMembrane fractionation
DimerizationLeu/Ile in coiled-coilCharged residue substitutionDisrupted dimerizationGel filtration, crosslinking
δ-interactionC-terminal basic residuesCharge reversalWeakened F1 associationPull-down assays
Flexible linkerPro/Gly residuesRigid residue substitutionAltered stator flexibilityATP synthesis kinetics

Similar mutagenesis approaches have been successfully applied to other R. leguminosarum proteins, where targeted mutations followed by functional analysis revealed specific roles of protein domains . For instance, expression of the lpxE gene in E. coli behind the T7 lac promoter allowed detailed structure-function studies of this lipid phosphatase .

How can comparative genomics be used to identify species-specific features of atpG in R. leguminosarum bv. trifolii?

Comparative genomics offers valuable insights into the evolution and specific adaptations of atpG in R. leguminosarum bv. trifolii compared to other bacterial species. This approach can identify unique features that may relate to its symbiotic lifestyle:

  • Genomic comparison strategy:

    • Identify atpG orthologs across diverse bacterial species

    • Generate multiple sequence alignments to identify conserved and variable regions

    • Analyze synteny of the atp operon across rhizobial species

    • Examine selection pressures on different protein domains

  • Bioinformatic workflow:

    • Sequence retrieval from genomic databases (NCBI, Rhizobase)

    • BLAST and HMM-based homology searches

    • Multiple sequence alignment using MUSCLE or MAFFT

    • Phylogenetic analysis using maximum likelihood methods

    • Selection pressure analysis using dN/dS ratios

  • Key comparative groups:

    • Closely related rhizobia (R. etli, R. leguminosarum bv. viciae)

    • Other α-proteobacteria (Sinorhizobium, Bradyrhizobium)

    • Non-symbiotic soil bacteria

    • Distantly related bacteria with known ATP synthase structures

  • Analysis framework for interpreting findings:

Sequence FeatureAnalysis MethodBiological SignificanceExample Finding
Conserved domainsDomain prediction toolsCore functional regionsDimerization motifs
Variable regionsEntropy analysisAdaptation to specific environmentsHost-specific variations
Rhizobia-specific motifsMotif discovery toolsPotential symbiotic adaptationsUnique C-terminal sequences
Operon organizationSynteny analysisTranscriptional regulation differencesPromoter variations
Selection hotspotsdN/dS analysisRegions under positive selectionAdaptation signatures

Similar comparative approaches have been applied to other R. leguminosarum proteins, revealing important insights about protein function and evolution. For instance, analysis of LpxE revealed potential orthologs in intracellular pathogens like Francisella tularensis, Brucella melitensis, and Legionella pneumophila , suggesting convergent evolution of certain membrane-associated proteins.

What are the most common issues when working with recombinant atpG and how can they be resolved?

Working with recombinant atpG from R. leguminosarum bv. trifolii presents several experimental challenges. Based on research with similar membrane-associated proteins in rhizobia, here are systematic approaches to common issues:

  • Low expression yield:

    • Issue: atpG is a membrane-associated protein often expressed at lower levels

    • Diagnosis: Western blot comparison of various expression conditions

    • Solution: Optimize codon usage; use specialized strains like C41/C43; lower induction temperature to 16-20°C

    • Validation: Quantitative comparison of expression levels under different conditions

  • Protein insolubility:

    • Issue: Formation of inclusion bodies due to hydrophobic regions

    • Diagnosis: Analyze soluble vs. insoluble fractions after cell lysis

    • Solution: Use gentle lysis methods combining lysozyme (1 mg/ml) and EDTA (2 mM); add mild detergents; consider fusion tags

    • Validation: SDS-PAGE analysis of soluble fraction

  • Improper folding:

    • Issue: Recombinant protein lacks structural integrity

    • Diagnosis: Circular dichroism spectroscopy; limited proteolysis

    • Solution: Co-express with chaperones; optimize membrane-mimetic environments

    • Validation: Functional complementation assays

  • Troubleshooting decision framework:

ProblemDiagnostic MethodPrimary SolutionAlternative ApproachSuccess Indicator
Low expressionWestern blotChange expression strainModify vector/promoterDetectable target band
Inclusion bodiesFractionation analysisLower induction temperatureSolubility-enhancing tagsIncreased soluble fraction
Protein degradationTime-course analysisAdd protease inhibitorsRemove protease sitesStable full-length protein
Non-functional proteinActivity assaysOptimize buffer conditionsNative purificationComplementation activity
Poor membrane associationMembrane fractionationAdjust detergent concentrationLiposome reconstitutionMembrane co-fractionation

Research with R. leguminosarum proteins has shown that careful optimization of extraction and purification protocols is essential. For example, studies with RosR demonstrated that different protein fractions (extracellular, membrane, and periplasmic) require specific isolation techniques for optimal results .

How can researchers optimize experimental conditions for functional studies of atpG?

Optimizing experimental conditions for functional studies of atpG requires careful consideration of the protein's native environment and its role in the ATP synthase complex. Based on research with membrane proteins in R. leguminosarum, consider these optimization strategies:

  • Buffer optimization:

    • pH range: Test pH 6.5-8.0 to identify optimal stability and activity

    • Ionic strength: Evaluate 50-200 mM salt concentrations

    • Divalent cations: Include Mg²⁺ (5-10 mM) essential for ATP synthase function

    • Stabilizing agents: Add glycerol (10-20%) to enhance stability

  • Membrane environment reconstitution:

    • Detergent selection: Screen multiple detergents (DDM, LDAO, Triton X-100)

    • Lipid composition: Include phospholipids similar to R. leguminosarum membranes

    • Protein:lipid ratio: Optimize for proper integration (typically 1:50-1:200)

    • Reconstitution method: Compare direct incorporation vs. detergent removal techniques

  • Protein-protein interaction conditions:

    • Component ratio: Titrate interacting subunits to find optimal stoichiometry

    • Assembly order: Test sequential vs. simultaneous addition of components

    • Incubation parameters: Optimize temperature and time for complex formation

    • Stabilizing factors: Identify conditions that promote stable complex assembly

  • Optimization framework:

Experimental GoalVariables to OptimizeMeasurement MethodSuccess Criteria
Protein stabilityBuffer composition, temperatureThermal shift assayIncreased melting temperature
Membrane associationDetergent type, concentrationFlotation assayMembrane co-migration
Complex assemblyComponent ratios, incubation timeBlue native PAGEHigh-MW complex formation
Functional reconstitutionProteoliposome compositionATP synthesis assayActivity comparable to native
Structural integrityBuffer additives, pHCircular dichroismNative-like secondary structure

Research with membrane proteins in R. leguminosarum has demonstrated that optimization of membrane protein extraction and reconstitution conditions is critical for preserving function. For example, studies of membrane protein profiles showed that different extraction methods significantly affected protein recovery and activity .

How can atpG be used as a tool to study energetics during Rhizobium-legume symbiosis?

The ATP synthase subunit atpG provides a valuable molecular tool for investigating the energetic aspects of Rhizobium-legume symbiosis. By manipulating and monitoring this protein, researchers can gain insights into the bioenergetic requirements of nitrogen fixation:

  • Reporter system applications:

    • Fusion of atpG promoter with reporter genes (GFP, LUX) to monitor expression dynamics

    • Correlation of expression patterns with symbiotic stages and nodule development

    • Spatial analysis of energy demands throughout the nodule using microscopy techniques

  • Genetic manipulation strategies:

    • Creation of conditional mutants to control ATP synthase activity at different symbiotic stages

    • Expression of modified atpG variants with altered efficiency to determine energy thresholds

    • Complementation studies comparing wild-type and engineered atpG variants

  • Bioenergetic analysis approaches:

    • Measurement of ATP/ADP ratios in bacteroids with different atpG variants

    • Correlation of nitrogenase activity with ATP synthase capacity

    • Analysis of carbon flux allocation between energy production and other processes

  • Comparative analysis framework:

Research ApproachInformation ProvidedMethodologyApplication to Symbiosis
Expression profilingTemporal energy demandsRT-qPCR, reporter fusionsIdentify key energetic transitions
Mutant analysisMinimum energy requirementsConditional mutationsDetermine bioenergetic thresholds
Metabolic flux analysisCarbon allocation patterns¹³C labeling, metabolomicsOptimize energy production
Comparative performanceHost specificity effectsCross-inoculation studiesEnhance symbiotic efficiency

Research on R. leguminosarum has demonstrated that protein expression patterns change significantly during symbiotic development, with membrane and transport proteins showing particularly dynamic regulation . Studies have shown that mutations affecting membrane proteins can significantly impact symbiotic performance, highlighting the importance of energy metabolism in the symbiotic relationship .

What insights can atpG research provide about the evolution of symbiotic relationships in rhizobia?

Research on atpG in R. leguminosarum bv. trifolii offers valuable insights into the evolutionary adaptations that enable effective symbiotic relationships with legume hosts. By examining this critical component of energy metabolism, researchers can understand how rhizobia evolved to meet the unique bioenergetic challenges of symbiosis:

  • Evolutionary adaptations in atpG:

    • Sequence variations that may reflect adaptation to host-specific environments

    • Structural modifications that optimize ATP synthase function under microaerobic nodule conditions

    • Regulatory elements that coordinate energy production with nitrogen fixation

  • Comparative evolutionary analysis approaches:

    • Phylogenetic analysis of atpG across symbiotic and non-symbiotic bacteria

    • Identification of selection signatures indicating adaptive evolution

    • Correlation of sequence variations with host range and symbiotic efficiency

    • Examination of horizontal gene transfer events shaping ATP synthase evolution

  • Functional consequences of evolution:

    • Biochemical characterization of atpG variants from different rhizobial species

    • Assessment of how evolutionary changes affect ATP synthesis efficiency

    • Correlation of atpG diversity with ecological niches and host preferences

  • Evolutionary insights framework:

Evolutionary AspectAnalysis ApproachPotential FindingSignificance for Symbiosis
Sequence divergencePhylogenetic analysisClades correlating with host rangeHost adaptation mechanisms
Selection pressuredN/dS calculationPositively selected domainsKey functional adaptations
Regulatory evolutionPromoter analysisHost-responsive elementsCoordination with symbiosis
Horizontal transferGenomic island detectionAcquisition of adaptive featuresEvolutionary innovation

Research on other R. leguminosarum proteins has revealed that specialized functions, such as the lipid A modifications catalyzed by LpxE, are present in rhizobia but absent in many non-symbiotic bacteria . Similar analyses of atpG could reveal adaptations specific to the symbiotic lifestyle. The finding that LpxE orthologs are present in some intracellular pathogens suggests convergent evolution for host interaction , which might also apply to energy metabolism components.

What are promising new approaches for studying the regulation of atpG expression in R. leguminosarum bv. trifolii?

Emerging technologies offer new opportunities to understand the complex regulation of atpG expression in R. leguminosarum bv. trifolii at unprecedented resolution. Based on recent advances in molecular biology, several promising approaches deserve consideration:

  • Advanced transcriptional analysis techniques:

    • RNA-seq to capture global expression changes under diverse conditions

    • ChIP-seq to identify transcription factors binding to atpG promoter regions

    • ATAC-seq to assess chromatin accessibility and regulatory element activity

    • Single-cell RNA-seq to examine expression heterogeneity in bacterial populations

  • Genome editing and synthetic biology approaches:

    • CRISPR-Cas systems adapted for precise genomic modifications in rhizobia

    • Synthetic promoter libraries to dissect regulatory elements

    • Optogenetic control systems for temporal regulation studies

    • Biosensors reporting ATP levels and ATP synthase activity in real-time

  • High-throughput screening methodologies:

    • Transposon sequencing (Tn-seq) to identify genes influencing atpG expression

    • Bar-coded promoter variant libraries to identify key regulatory elements

    • Automated microfluidic systems for single-cell analysis of gene expression dynamics

    • Multiplexed reporter systems for simultaneous monitoring of multiple genes

  • Framework for new methodological approaches:

ApproachTechnical InnovationApplication to atpGExpected Insight
CRISPRiTargeted transcriptional repressionTunable atpG expressionThreshold requirements
Single-molecule imagingFluorescent protein fusionsATP synthase assembly dynamicsComplex formation kinetics
Ribosome profilingTranscription-translation couplingPost-transcriptional regulationRegulatory mechanisms
Metabolic flux analysis¹³C labeling coupled with MSEnergy allocation patternsMetabolic integration

Research on R. leguminosarum has already demonstrated the value of transcriptome profiling for understanding global regulatory networks. For example, studies of the RosR regulatory protein revealed its influence on numerous genes involved in cell-surface components, polysaccharides, motility, and metabolism . Similar comprehensive approaches could reveal the regulatory network controlling atpG expression.

How might engineered variants of atpG contribute to improving symbiotic nitrogen fixation in agricultural settings?

Engineered variants of atpG hold potential for enhancing symbiotic nitrogen fixation in agricultural applications by optimizing energy production in R. leguminosarum bv. trifolii. This biotechnological approach could lead to more efficient plant-microbe partnerships:

  • Engineering strategies for enhanced performance:

    • Optimization of atpG sequence for increased ATP synthase stability under stress conditions

    • Modification of regulatory elements for sustained expression during symbiosis

    • Engineering of protein interfaces for improved complex assembly efficiency

    • Introduction of beneficial features from other bacterial species

  • Performance enhancement targets:

    • Increased ATP production efficiency under microaerobic conditions

    • Enhanced stability during temperature and pH fluctuations in soil

    • Improved coordination with nitrogen fixation machinery

    • Accelerated bacteroid differentiation and nitrogen fixation initiation

  • Testing and validation approaches:

    • Laboratory assessment of ATP production rates in engineered strains

    • Greenhouse trials measuring nitrogen fixation efficiency

    • Field trials under varied environmental conditions

    • Metabolomic analysis of energy status in engineered bacteroids

  • Biotechnological application framework:

Engineering TargetApproachExpected BenefitAssessment Method
Expression levelPromoter engineeringOptimized ATP productionATP/ADP ratio measurement
Stress toleranceStabilizing mutationsPerformance under stressGrowth under challenging conditions
Complex assemblyInterface optimizationMore efficient bioenergeticsATP synthesis rate
Host compatibilityHost-specific adaptationsBroader host rangeCross-inoculation studies

Research on R. leguminosarum proteins has demonstrated the feasibility of genetic engineering approaches. For example, the lpxE gene has been successfully expressed in heterologous hosts, conferring new properties such as resistance to polymyxin . Similar approaches with atpG could potentially enhance symbiotic performance. Studies of the RosR regulatory protein have shown how complex phenotypes including motility, cell-surface properties, and metabolism can be influenced by modifying key regulatory proteins , suggesting that targeted modifications of energy metabolism components could have significant impacts on symbiotic performance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.