Recombinant Rhizobium leguminosarum bv. trifolii Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rhizobium leguminosarum bv. trifolii Large-conductance Mechanosensitive Channel (mscL)

The Recombinant Rhizobium leguminosarum bv. trifolii Large-conductance Mechanosensitive Channel (mscL) is a protein derived from the bacterium Rhizobium leguminosarum bv. trifolii, which is known for its symbiotic relationship with legumes like clover. This channel plays a crucial role in maintaining cellular integrity by responding to mechanical stress, such as osmotic changes, in the bacterial membrane. The recombinant form of this protein is produced through genetic engineering techniques, allowing for its study and application in various scientific and medical contexts.

Structure and Function

The Large-conductance Mechanosensitive Channel (mscL) is a homopentameric protein, meaning it consists of five identical subunits. Each subunit contains two transmembrane regions, which are essential for its function in sensing mechanical forces within the lipid bilayer of the bacterial cell membrane. When the cell experiences osmotic stress or mechanical stretch, mscL opens to allow ions and water to flow out, thereby preventing cell lysis by reducing internal pressure .

Protein CharacteristicsDescription
StructureHomopentameric
Subunit CompositionFive identical subunits, each with two transmembrane regions
FunctionResponds to mechanical stress by opening to allow ion and water flow
Role in Cell SurvivalPrevents cell lysis during osmotic shock

Recombinant Production and Applications

Recombinant production of the Rhizobium leguminosarum bv. trifolii mscL involves cloning the gene encoding this protein into an expression vector, followed by expression in a suitable host organism. This allows for large-scale production and purification of the protein for research and potential therapeutic applications. The recombinant mscL is available in various quantities and is stored in a Tris-based buffer with glycerol to maintain stability .

Recombinant Protein DetailsDescription
QuantityTypically 50 µg, with options for larger quantities
Storage BufferTris-based buffer, 50% glycerol
Storage Conditions-20°C or -80°C for extended storage
Potential ApplicationsResearch into bacterial mechanosensation, potential therapeutic targets

Research Findings and Implications

Research on mscL has highlighted its importance in bacterial survival under stress conditions. The channel's ability to respond to mechanical forces makes it a potential target for developing new antibiotics, particularly against drug-resistant bacterial strains . Additionally, studying mscL can provide insights into the mechanisms of mechanosensation in bacteria, which could have broader implications for understanding cellular responses to environmental stressors.

Research ImplicationsDescription
Potential Therapeutic TargetsDevelopment of new antibiotics against drug-resistant bacteria
Mechanosensation InsightsUnderstanding how bacteria respond to mechanical stress
Broader ApplicationsInsights into cellular stress responses and potential applications in biotechnology

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If a particular tag is required, please inform us, and we will prioritize its development.
Synonyms
mscL; Rleg2_0225; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Target Names
mscL
Target Protein Sequence
MLNEFKAFIARGNVMDLAVGVIIGGAFGGIVKSLVDDLIMPIVGAIFGGFDFSNYFLPLS SAVNAPTLAAARAQGAVFAYGSFLTVLINFLILAWIIFLMVKGVNYLRLQVERQEKAAPE ELPPPPADVQLLTEIRDLLATRPTA
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the mscL channel function in bacterial membranes?

The mscL channel functions as a tension-sensitive protein gate in the bacterial membrane. Based on experimental data, this channel responds directly to mechanical stimuli, particularly membrane tension . The functional mechanism involves:

  • Sensing mechanism: The channel directly senses lateral tension in the lipid bilayer without requiring additional cellular components.

  • Gating process: When sufficient membrane tension is applied (approximately 12 dynes/cm in patch clamp experiments), the channel undergoes conformational changes that lead to pore opening .

  • Conductance properties: Functional reconstitution studies show that purified recombinant mscL forms ion channels with characteristic conductance measurements of approximately 90 pA at +30 mV in 200 mM KCl solutions .

  • Ion permeability: When open, the channel allows passage of ions and small molecules, maintaining a non-selective permeability that helps relieve internal pressure during osmotic stress.

  • Inhibition properties: Channel activity can be blocked by specific mechanosensitive ion channel inhibitors such as gadolinium .

The gating mechanism involves significant structural rearrangements that can be studied through experimental techniques combining electrophysiology with structural biology approaches .

What experimental systems are available for studying recombinant mscL?

Several experimental systems have been developed for studying recombinant mscL, each with specific advantages:

  • Purified protein reconstitution systems:

    • Artificial liposomes with reconstituted mscL protein provide a controlled environment for functional studies

    • The purified protein can be reconstituted into liposomes and studied using patch-clamp techniques to assess channel activity

    • This approach allows precise control of lipid composition and protein density

  • Droplet Hydrogel Bilayers (DHBs):

    • A novel platform where proteoliposomes containing mscL can fuse with bilayers, facilitating channel reconstitution

    • Mechanical stimulation can be precisely controlled by injecting nanoliter volumes of buffer into the droplet

    • This method allows direct correlation between applied force and channel activation

  • Expression systems:

    • Recombinant mscL can be expressed as a fusion protein with glutathione S-transferase (GST)

    • Expression in an E. coli strain containing a disruption in the chromosomal mscL gene prevents contamination with host mscL

  • Computational models:

    • Coarse-grained molecular dynamics simulations allow modeling of mscL gating

    • Incorporating experimental restraints from EPR and FRET experiments enhances the accuracy of these models

Each system offers unique advantages for investigating different aspects of mscL structure and function, from molecular dynamics to electrophysiological properties.

What is the optimal protocol for expressing and purifying recombinant R. leguminosarum bv. trifolii mscL?

Based on established methodologies for mechanosensitive channels, a recommended protocol for expression and purification of recombinant R. leguminosarum bv. trifolii mscL includes:

Expression Protocol:

  • Clone the mscL gene from R. leguminosarum bv. trifolii into an expression vector as a fusion with glutathione S-transferase (GST)

  • Transform the plasmid into an E. coli expression strain (preferably one with a disruption in the chromosomal mscL gene)

  • Grow transformed bacteria in appropriate media at optimal temperature (typically 37°C)

  • Induce protein expression with an appropriate inducer (e.g., IPTG)

  • Harvest cells by centrifugation and prepare for protein extraction

Purification Protocol:

  • Lyse cells using a combination of enzymatic digestion (lysozyme) and mechanical disruption

  • Solubilize membrane proteins using appropriate detergents

  • Purify the fusion protein using glutathione-coated beads for affinity chromatography

  • Perform thrombin cleavage to separate the mscL protein from the GST tag

  • Conduct additional purification steps as needed (ion exchange, size exclusion)

  • Store the purified protein in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage

Quality Control:

  • Verify protein purity using SDS-PAGE

  • Confirm identity using mass spectrometry or N-terminal sequencing

  • Test functionality by reconstitution into liposomes followed by patch-clamp analysis

  • Check for characteristic conductance and pressure sensitivity

This protocol provides a systematic approach for obtaining functional recombinant mscL suitable for subsequent experimental applications.

How can functional reconstitution of recombinant mscL be performed effectively?

Functional reconstitution of recombinant mscL requires careful attention to membrane composition and reconstitution conditions. The following methodological approach is recommended:

Liposome Preparation:

  • Select appropriate lipids that mimic the native bacterial membrane environment

  • Prepare a lipid mixture in organic solvent (e.g., chloroform)

  • Evaporate the solvent to form a thin lipid film

  • Hydrate the film with buffer to form multilamellar vesicles

  • Perform extrusion or sonication to create unilamellar liposomes of defined size

Protein Reconstitution:

  • Solubilize purified mscL in a mild detergent (e.g., n-dodecyl-β-D-maltoside)

  • Mix the solubilized protein with preformed liposomes

  • Remove detergent using biobeads, dialysis, or controlled dilution

  • Verify reconstitution by density gradient centrifugation or freeze-fracture electron microscopy

Functional Testing:

  • Form gigaohm seals on proteoliposomes using patch-clamp pipettes

  • Apply negative pressure to induce membrane tension

  • Record channel activity at different membrane potentials

  • Analyze single-channel conductance and pressure sensitivity

  • Verify characteristic conductance (approximately 90 pA at +30 mV in 200 mM KCl)

Alternative Approach - Droplet Hydrogel Bilayers (DHBs):

  • Form a droplet-hydrogel interface to create a stable bilayer

  • Add proteoliposomes containing mscL to the chamber

  • Allow fusion of proteoliposomes with the bilayer (approximately 1 hour)

  • Insert electrodes for electrical measurements

  • Inject buffer into the droplet using a nanoinjector to induce tension

  • Record channel activity as tension activates mscL channels

These methods enable effective reconstitution and functional characterization of recombinant R. leguminosarum bv. trifolii mscL in controlled membrane environments.

What approaches can be used to study the relationship between mscL function and bacterial stress adaptation?

To investigate the relationship between mscL function and bacterial stress adaptation in R. leguminosarum bv. trifolii, researchers can employ several complementary approaches:

Genetic Manipulation Studies:

  • Generate mscL knockout mutants using integrative mutagenesis

  • Create strains with modified mscL expression levels

  • Develop point mutations that alter channel gating properties

  • Compare these strains with wild-type bacteria in stress response assays

Stress Challenge Experiments:

  • Subject bacteria to osmotic downshock conditions

  • Expose cultures to mechanical stresses relevant to soil environments

  • Test survival rates under fluctuating osmotic conditions

  • Measure growth kinetics during osmotic stress recovery

Surface Property Analysis:

  • Characterize cell surface properties including:

    • Electrophoretic mobility

    • Surface charge density

    • Hydrophobicity (water contact angle)

    • Surface free energy

  • Compare these properties between wild-type and mscL mutant strains

Symbiotic Performance Assessment:

  • Evaluate nodulation efficiency on clover plants

  • Measure competitive nodulation ability in mixed inoculations

  • Assess nitrogen fixation capability

  • Examine the correlation between stress tolerance and symbiotic effectiveness

Molecular Mechanism Investigation:

  • Study mscL activation under different stress conditions

  • Examine the relationship between mscL and exopolysaccharide production

  • Investigate potential interactions with regulatory proteins like RosR

  • Analyze transcriptomic changes in response to stress in wild-type vs. mscL mutants

This integrated approach provides comprehensive insights into how mscL contributes to bacterial stress adaptation and symbiotic competence in R. leguminosarum bv. trifolii.

How do mutations in mscL affect channel gating and bacterial physiology?

Mutations in mscL can significantly alter channel gating properties and consequently impact bacterial physiology. Research approaches to investigate these effects include:

Gating Property Analysis:

  • Specific mutations like G22S reduce the tension threshold for channel opening by approximately 30% compared to wild-type mscL

  • G22E mutations can result in spontaneous current traces representative of mscL gating even without applied tension

  • These mutations can be characterized through electrophysiological recordings to determine:

    • Changes in tension sensitivity

    • Alterations in conductance

    • Modified gating kinetics

    • Channel open probability under basal conditions

Bacterial Physiology Impact:

  • Mutations affecting mscL function may influence:

    • Cell surface properties, including electrophoretic mobility and hydrophobicity

    • Osmotic stress tolerance and recovery

    • Cell integrity during rapid environmental changes

    • Exopolysaccharide production, which is crucial for symbiotic relationships

Symbiotic Relationship Effects:

  • Similar to what has been observed with rosR mutations, alterations in mscL function might affect:

    • Attachment and colonization of root hairs

    • Infection thread initiation and development

    • Competitive nodulation ability

    • Nitrogen fixation efficiency

Competitive Fitness Assessment:

  • In mixed inoculation experiments, strains with altered mscL function may show:

    • Changed competitive index in nodule occupation

    • Modified ability to survive in soil environments

    • Altered adaptation to osmotic fluctuations

    • Different colonization patterns on plant roots

Understanding these relationships between channel mutations, molecular function, and bacterial physiology provides crucial insights for potential applications in agricultural biotechnology.

How can computational modeling improve our understanding of mscL gating mechanisms?

Computational modeling offers powerful tools for investigating mscL gating mechanisms at the molecular level. Based on current approaches in mechanosensitive channel research:

Coarse-Grained Molecular Dynamics Simulations:

  • This approach reduces system complexity by representing multiple atoms as single particles

  • It allows simulations in the microsecond range due to larger time steps

  • Enhanced sampling efficiency results from fewer effective interactions between particles

  • These models can simulate mscL behavior with and without applied tension

Integration of Experimental Data with Computational Models:

  • Inter-subunit distances and solvent accessibility data from EPR and FRET experiments can be incorporated as restraints

  • This creates models consistent with experimental observations

  • Simulation with restraints allows achievement of conformational sampling without excessive tension

  • Multiple simulations (microsecond range) provide greater conformational exploration than single shorter simulations

Specific Modeling Approaches:

  • Starting with a homology model of R. leguminosarum bv. trifolii mscL based on existing crystal structures

  • Embedding the protein in a lipid bilayer with appropriate composition

  • Applying physiologically relevant tension values (12-30 dynes/cm)

  • Incorporating experimental restraints to guide the simulation

  • Running multiple simulations to enhance sampling

Analysis of Structural Transitions:

  • Monitoring pore diameter changes during channel opening

  • Tracking subunit rearrangements and interface changes

  • Analyzing water and ion accessibility to the channel pore

  • Identifying key residues involved in tension sensing and channel gating

The computational approaches provide atomic-level insights into gating mechanisms that complement experimental findings and inform the design of future experiments or biotechnological applications.

What methodological approaches can resolve contradictions in experimental data on mscL function?

Contradictions in experimental data on mscL function can arise from various sources including methodological differences, sample preparation variations, and inherent biological complexity. The following approaches can help resolve such contradictions:

Standardization of Experimental Protocols:

  • Establish consistent methods for:

    • Protein expression and purification

    • Membrane reconstitution procedures

    • Electrophysiological recording conditions

    • Data analysis parameters

Multi-method Validation Approach:

  • Employ complementary techniques to investigate the same phenomenon:

    • Combine patch-clamp electrophysiology with fluorescence-based flux assays

    • Validate structural models with both computational and experimental methods

    • Use both in vitro reconstitution and in vivo functional assays

  • Cross-validate findings across different experimental platforms to identify consensus results

Context-Dependent Analysis:

  • Systematically evaluate how experimental conditions affect results:

    • Lipid composition effects on channel properties

    • Influence of temperature, pH, and ionic strength

    • Impact of protein density in membranes

    • Effects of experimental manipulation techniques

Statistical Approaches for Data Integration:

  • Meta-analysis of multiple datasets to identify consistent patterns

  • Bayesian analysis to incorporate prior knowledge with new experimental data

  • Sensitivity analysis to determine which factors most strongly influence outcomes

  • Uncertainty quantification to establish confidence levels for different findings

Contradiction Detection Framework:

  • Apply systematic methods to identify and categorize contradictions

  • Evaluate methodological rigor of conflicting studies

  • Determine whether contradictions reflect genuine biological complexity or methodological issues

  • Develop targeted experiments specifically designed to resolve key contradictions

By implementing these approaches, researchers can develop a more coherent understanding of mscL function and resolve apparent contradictions in the experimental literature.

How can the study of R. leguminosarum bv. trifolii mscL contribute to improved agricultural inoculants?

Research on R. leguminosarum bv. trifolii mscL has significant potential applications for developing improved agricultural inoculants:

Enhancement of Stress Tolerance:

  • Understanding how mscL contributes to osmotic adaptation could inform the development of strains with improved survival under field conditions

  • Engineering strains with optimized mscL function might enhance tolerance to drought and flooding cycles in agricultural soils

  • Selecting strains with favorable mscL variants could improve inoculant persistence in challenging environments

Improvement of Symbiotic Efficiency:

  • If mscL function influences symbiotic performance, selecting strains with optimal channel properties could enhance:

    • Nodulation efficiency

    • Nitrogen fixation rates

    • Competitive ability against indigenous soil rhizobia

Quality Control for Inoculant Production:

  • Understanding mscL's role in bacterial physiology could inform improved manufacturing processes:

    • Optimizing culture conditions for inoculant production

    • Enhancing survival during formulation and storage

    • Developing better carrier materials compatible with bacterial membrane properties

Selection Criteria for Superior Strains:

  • Similar to how NodD2 has been identified as a marker for enhanced competitive ability , mscL variants could potentially serve as selection criteria for highly competitive inoculant strains

  • Genetic screening for specific mscL characteristics could complement existing criteria for strain selection

  • Targeted mutagenesis of mscL could create strains with enhanced field performance

Future Research Directions:

  • Develop high-throughput screening methods to identify strains with optimal mscL properties

  • Investigate the relationship between mscL function and performance under different field conditions

  • Explore potential synergistic effects between mscL optimization and other traits beneficial for inoculant performance

These applications could contribute to developing more effective clover inoculants for sustainable agriculture, reducing reliance on chemical nitrogen fertilizers.

What methodological challenges remain in studying mechanosensitive channels in symbiotic bacteria?

Despite significant advances, several methodological challenges persist in studying mechanosensitive channels in symbiotic bacteria:

Technical Challenges in Native Membrane Studies:

  • Difficulties in performing patch-clamp studies on bacteria in their native state due to:

    • Small cell size

    • Presence of cell wall

    • Complex membrane composition

  • Limited tools for real-time monitoring of channel activity during symbiotic processes

  • Challenges in correlating in vitro channel properties with in vivo function

Complexity of Symbiotic Environments:

  • Difficulty replicating the complex physical and chemical environment of the rhizosphere

  • Challenges in simulating the changing conditions bacteria experience during infection and nodule formation

  • Limited understanding of mechanical forces experienced by bacteria during symbiotic processes

Protein Structure Determination:

  • Challenges in obtaining high-resolution structures of R. leguminosarum bv. trifolii mscL in different conformational states

  • Difficulties in capturing transient intermediate states during channel gating

  • Technical hurdles in structural studies of membrane proteins

Functional Analysis in Symbiotic Context:

  • Limited methods for studying channel function during actual symbiotic interactions

  • Difficulties in distinguishing mscL-specific effects from other factors affecting symbiosis

  • Challenges in identifying physiological stimuli that activate mscL during plant infection

Future Methodological Approaches:

  • Development of in situ imaging techniques to visualize channel activity during symbiosis

  • Creation of biosensors that report on mechanical stress experienced by bacteria

  • Implementation of microfluidic devices to apply controlled mechanical stimuli to bacteria

  • Application of advanced computational methods that integrate structural, functional, and physiological data

Addressing these challenges will require interdisciplinary approaches combining expertise in electrophysiology, structural biology, bacterial genetics, plant-microbe interactions, and computational modeling.

How can contradictions between in vitro and in vivo findings about mscL function be reconciled?

Reconciling contradictions between in vitro and in vivo findings about mscL function requires systematic approaches that bridge these different experimental contexts:

Sources of Potential Contradictions:

  • Membrane environment differences:

    • Artificial membranes used in vitro lack the complex composition of bacterial membranes

    • Lipid composition affects mscL function, potentially creating discrepancies

    • Membrane curvature and tension distribution differ between liposomes and living cells

  • Cellular context factors:

    • Interactions with other proteins may modify mscL function in vivo

    • Cytoplasmic crowding can influence channel dynamics

    • Cell wall-membrane interactions present in vivo but absent in reconstituted systems

  • Experimental conditions:

    • Methods of applying tension differ between patch-clamp (direct) and osmotic shock (indirect)

    • Temperature, pH, and ionic conditions may vary between experimental settings

    • Temporal aspects of stress application differ between acute in vitro and gradual in vivo changes

Methodological Approaches for Reconciliation:

  • Bridging experiments:

    • Develop intermediate systems that progressively increase complexity

    • Study mscL in spheroplasts to maintain cellular components while enabling patch-clamp

    • Use cell-derived vesicles that maintain native membrane composition

  • Complementary methodologies:

    • Combine in vitro biophysical characterization with in vivo functional assays

    • Correlate channel properties measured in vitro with cellular phenotypes

    • Develop in vivo reporters of channel activity to directly compare with in vitro measurements

  • Computational integration:

    • Use simulation approaches that incorporate both structural and functional data

    • Develop models that bridge different spatial and temporal scales

    • Predict how in vitro observed properties would manifest in the cellular context

  • Systematic mutational analysis:

    • Create mutations with defined effects in vitro and test their consequences in vivo

    • Use genetic suppressor analysis to identify interacting factors in vivo

    • Engineer chimeric channels to identify domains responsible for context-dependent differences

By systematically addressing these factors, researchers can develop a more unified understanding of mscL function that reconciles apparent contradictions between different experimental approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.