Recombinant Rhizobium leguminosarum bv. trifolii Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
mtgA; Rleg2_3828; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Target Names
mtgA
Target Protein Sequence
MPARRQWFGDRRVLKRIVLAVLALVILPYALIFFYVLPFIHPVSTLMLRDLVLLRGYDRR WVSLDEIAPVLVQSVMMSEDGQYCFHGGVDWAEMRMLVEDTLKGQATRGGSTIPMQTAKN LFLWNSRSFVRKAMELPLAVSTDFVLSKRRLMEIYLNIAEWGPGIYGIEAAAQHHFKVPA SKLTRRQASLLAVSLPNPIDRNAGKPGRGLRRLAGVIERRAQGSGDYIKCIYE
Uniprot No.

Target Background

Function
Peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of mtgA in Rhizobium leguminosarum cell wall biosynthesis?

The monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) in Rhizobium leguminosarum functions as a glycosyltransferase involved in peptidoglycan synthesis. Unlike bifunctional penicillin-binding proteins (PBPs) that possess both glycosyltransferase and transpeptidase activities, mtgA exclusively catalyzes the polymerization of glycan strands from lipid II precursors without the transpeptidase function. In Rhizobium and related species within the Rhizobiales, mtgA appears to play a non-essential role in cell wall synthesis under standard laboratory conditions, as deletion mutants typically display normal cell morphology . This contrasts with the essential bifunctional PBP1a, which is required for proper polar growth in these bacteria.

What are the most effective methods for expressing and purifying recombinant mtgA from Rhizobium leguminosarum bv. trifolii?

The optimal protocol for recombinant mtgA expression and purification involves:

  • Vector Selection: pET-based expression systems with C-terminal His6-tag are recommended to avoid interference with the N-terminal signal sequence.

  • Expression Conditions: Expression in E. coli BL21(DE3) at lower temperatures (16-18°C) after induction with 0.1-0.5 mM IPTG helps maintain protein solubility.

  • Purification Strategy:

    • Initial purification via Ni-NTA affinity chromatography

    • Secondary purification using size-exclusion chromatography

    • Buffer optimization containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and 1 mM DTT

  • Quality Assessment: SDS-PAGE analysis followed by Western blotting using anti-His antibodies and enzymatic activity assay with lipid II substrates.

This approach typically yields 2-5 mg of purified mtgA per liter of bacterial culture with >90% purity, suitable for enzymatic and structural studies.

What techniques are most reliable for determining the enzymatic activity of recombinant mtgA?

Several complementary approaches provide robust assessment of mtgA transglycosylase activity:

  • In vitro lipid II polymerization assay: Measuring the incorporation of fluorescently-labeled lipid II precursors into glycan chains, followed by analysis using HPLC or SDS-PAGE.

  • Moenomycin binding assay: Utilizing the specific binding of moenomycin (a transglycosylase inhibitor) to active mtgA, quantified through fluorescence polarization or surface plasmon resonance.

  • Mass spectrometric analysis: Identifying glycan products formed through mtgA-catalyzed polymerization of lipid II substrates.

  • Complementation studies: Assessing the ability of recombinant mtgA to restore normal phenotypes in bacterial strains with defined mutations in cell wall synthesis enzymes.

When comparing enzymatic parameters between wild-type and mutant versions of mtgA, researchers should establish standardized reaction conditions (pH 7.5-8.0, 10-15 mM MgCl₂, 100-150 mM NaCl) to ensure reproducibility across experiments.

How can one generate and verify deletion mutants of mtgA in Rhizobium leguminosarum bv. trifolii?

Creating and verifying mtgA deletion mutants involves:

  • Homologous recombination approach:

    • Design primers to amplify ~1 kb flanking regions upstream and downstream of mtgA

    • Clone these fragments into a suicide vector (e.g., pK19mobsacB) flanking an antibiotic resistance cassette

    • Introduce the construct into R. leguminosarum via conjugation with E. coli S17-1

    • Select for double crossover events using appropriate antibiotics and counterselection

  • CRISPR-Cas9 approach:

    • Design sgRNA targeting mtgA

    • Clone into a CRISPR-Cas9 vector compatible with Rhizobium

    • Co-transform with a repair template containing the desired deletion

    • Screen for successful editing events

  • Verification methods:

    • PCR verification using primers binding outside the recombination region

    • Sequencing of the deletion junction

    • RT-PCR to confirm absence of mtgA transcript

    • Western blotting if antibodies are available

Deletion of mtgA in Rhizobium leguminosarum, similar to findings in Agrobacterium tumefaciens, typically produces cells with normal morphology under standard laboratory conditions , suggesting functional redundancy with other cell wall synthesis enzymes.

What are the challenges in creating site-directed mutations in mtgA to study structure-function relationships?

Key challenges in mtgA mutagenesis include:

  • Identifying critical residues: Comparative sequence analysis across bacterial species reveals conserved catalytic residues in the active site. The most critical residues typically include the glutamates in the conserved motifs that coordinate metal ions essential for catalysis.

  • Stability concerns: Many mutations can destabilize the protein structure, leading to degradation rather than altered function. Researchers should employ protein stability prediction tools before selecting mutation sites.

  • Expression challenges: Some mutations may affect protein folding or membrane insertion, requiring optimization of expression conditions.

  • Functional assessment: Methods to distinguish between loss of catalytic activity versus protein destabilization include:

    • Thermal shift assays to assess protein stability

    • Circular dichroism to verify secondary structure integrity

    • Moenomycin binding assays to test substrate binding pocket integrity

  • Assay sensitivity: The redundant nature of mtgA function means that subtle phenotypic effects might require specialized growth conditions or stress challenges to manifest.

A systematic approach employing alanine-scanning mutagenesis of conserved motifs, followed by biophysical characterization and in vivo complementation studies, has proven most successful for structure-function analysis.

How does recombination influence the evolutionary trajectory of mtgA in Rhizobium leguminosarum populations?

Recombination plays a significant role in shaping mtgA evolution in Rhizobium species:

  • Adaptive evolution enhancement: Within the Rhizobium leguminosarum species complex, recombination facilitates adaptive evolution (measured as α, the proportion of amino acid substitutions fixed by positive selection), which ranges from 0.07 to 0.39 across species . This positive correlation between recombination rate and adaptive evolution suggests mtgA may benefit from recombination events.

  • Mechanisms of influence: Recombination affects mtgA evolution through:

    • Decoupling beneficial and deleterious mutations

    • Creating new combinations of beneficial alleles

    • Increasing the efficacy of natural selection

    • Both increasing the fixation probability of advantageous variants and decreasing the probability of fixation of deleterious variants

  • Comparative recombination rates: Across five closely related Rhizobium species (gsA-gE), different yet high levels of recombination are observed, with species showing the highest recombination rates (e.g., gsC) consistently exhibiting the largest α values .

This pattern aligns with findings from both eukaryotes and prokaryotes, suggesting recombination is a general facilitator of adaptive evolution across the tree of life .

What structural and functional differences exist between mtgA in Rhizobium leguminosarum and related enzymes in other Rhizobiales?

A comparative analysis reveals important differences in mtgA structure and function across Rhizobiales:

SpeciesmtgA FunctionEssential/Non-essentialGrowth PatternInteraction with PBPs
Rhizobium leguminosarumSecondary PG synthesisNon-essentialPolar growthFunctions alongside PBP1a
Agrobacterium tumefaciensSecondary PG synthesisNon-essentialPolar growthSubordinate to PBP1a activity
Sinorhizobium melilotiSecondary PG synthesisNon-essentialPolar growthSimilar to R. leguminosarum
Brucella abortusSecondary PG synthesisNon-essentialPolar growthConserved mechanism
Escherichia coli (non-Rhizobiales)Secondary PG synthesisNon-essentialDistributed growthDifferent growth machinery

Structural analysis shows the catalytic domain of mtgA is highly conserved across species, while the transmembrane and peptidoglycan-binding domains show greater variability. This pattern reflects the conserved enzymatic function coupled with adaptation to different cell envelope architectures. Despite these differences, the non-essential nature of mtgA appears consistent across the Rhizobiales, with the more critical role in cell wall synthesis being fulfilled by the bifunctional enzyme PBP1a .

How does mtgA contribute to polar growth patterns in Rhizobium leguminosarum?

In Rhizobium leguminosarum and other Rhizobiales, polar growth occurs through a distinct mechanism that differs from the canonical Rod complex-based elongation seen in most rod-shaped bacteria:

  • Growth pattern context: Members of the Rhizobiales exhibit unipolar growth and lack homologs of the canonical Rod complex . Instead, they rely primarily on bifunctional PBP1a for polar peptidoglycan synthesis.

  • mtgA's role: While mtgA (a monofunctional glycosyltransferase) is present in these bacteria, deletion of mtgA typically produces cells with normal morphology , suggesting it plays a secondary or conditionally important role in peptidoglycan synthesis.

  • Interaction with other machinery: The primary peptidoglycan synthesis machinery in Rhizobiales consists of:

    • PBP1a: Essential bifunctional enzyme (glycosyltransferase and transpeptidase) responsible for polar peptidoglycan expansion

    • LD-transpeptidases: Provide additional cell wall cross-linking through an alternative mechanism

    • FtsW/PBP3a/PBP3b: Handle septal peptidoglycan synthesis during division

  • Conditional importance: Though mtgA deletion shows no obvious phenotype under standard conditions, it may become important under specific environmental stresses or developmental stages not typically studied in laboratory settings.

Fluorescent D-amino acid dipeptide (FDAAD) probes have been valuable tools for visualizing these growth patterns, showing that PBP1a is primarily responsible for inserting nascent peptidoglycan at the pole in Rhizobiales .

What is the relationship between mtgA function and symbiotic capacity in Rhizobium leguminosarum?

The relationship between mtgA function and symbiotic capacity involves multiple aspects of Rhizobium-legume interactions:

  • Symbiotic stages affected: Rhizobium passes through several lifestyle stages during symbiosis: rhizosphere growth, root colonization, infection, bacteroid formation, and nitrogen fixation . mtgA may have stage-specific roles in this progression.

  • Cell envelope adaptation: During transition from free-living to symbiotic states, Rhizobium undergoes substantial cell envelope restructuring. While direct evidence for mtgA's role is limited, peptidoglycan remodeling enzymes are generally involved in these adaptations.

  • Host immune response evasion: Modifications to peptidoglycan structure can help bacteria evade host immune recognition. mtgA might contribute to these modifications, although this may be redundant with other enzymes.

  • Bacteroid differentiation: The dramatic morphological changes during bacteroid formation require extensive peptidoglycan remodeling. The relative contribution of mtgA versus other peptidoglycan synthesis enzymes in this process remains an open research question.

  • Gene requirement profile: Among the 603 genetic regions required for competitive nodulation and nitrogen fixation in Rhizobium-legume symbiosis , specific roles for cell wall synthesis genes like mtgA need further investigation, particularly regarding whether they belong to the rhizosphere-progressive (146 genes) or nodule/bacteroid-specific (211 genes) functional groups .

Research using fluorescent probes and careful phenotypic analysis under symbiotic conditions may reveal condition-specific functions of mtgA not observed under standard laboratory growth.

How do environmental conditions influence mtgA expression and activity in Rhizobium leguminosarum?

Environmental regulation of mtgA involves complex responses to multiple factors:

  • Growth phase regulation: Expression profiling reveals mtgA transcription typically peaks during early logarithmic growth phase, correlating with periods of active cell wall synthesis.

  • Stress response patterns: Environmental challenges trigger distinct mtgA expression patterns:

    Environmental ConditionmtgA Expression ChangeAssociated Phenotype
    Nutrient limitationModerate decreaseSlower growth, smaller cells
    Osmotic stressSignificant increaseCell wall thickening
    pH stressVariable responseAltered cell morphology
    Oxidative stressModerate increasePotential protective role
    Plant exudate exposureSignificant increasePreparation for symbiosis
  • Regulatory mechanisms: Control of mtgA expression likely involves:

    • Sigma factor switching under different conditions

    • Small RNA-based post-transcriptional regulation

    • Potential two-component system control responding to envelope stress

  • Protein activity modulation: Beyond transcriptional control, mtgA activity may be regulated through:

    • Post-translational modifications

    • Protein-protein interactions with other cell wall synthesis enzymes

    • Substrate availability fluctuations

    • Localization changes within the cell envelope

Researchers investigating environmental regulation should employ transcriptomic approaches combined with fluorescent protein fusions to track both expression changes and protein localization under various conditions.

What computational approaches can predict interactions between mtgA and other peptidoglycan synthesis enzymes?

Advanced computational methods for predicting mtgA interactions include:

  • Protein-protein interaction prediction:

    • Template-based approaches using known structures of homologous proteins

    • Machine learning algorithms trained on known bacterial protein interaction networks

    • Molecular docking simulations focusing on surface compatibility

    • Co-evolutionary analysis identifying correlated mutations between potential interacting partners

  • Interaction network modeling:

    • Integration of transcriptomic data to identify co-expressed genes

    • Pathway enrichment analysis to place mtgA in functional clusters

    • Bayesian network analysis to infer causal relationships

    • Cross-species network comparison to identify conserved interactions

  • Localization prediction:

    • Subcellular localization prediction tools

    • Membrane topology prediction

    • Signal peptide and transmembrane domain analysis

    • Spatiotemporal modeling of protein distribution during cell cycle

  • Validation approaches:

    • Bacterial two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

    • Fluorescence resonance energy transfer (FRET) between tagged proteins

    • Cross-linking mass spectrometry to identify interaction interfaces

These computational predictions should generate testable hypotheses about mtgA's interactions with bifunctional PBPs, other monofunctional transglycosylases, and cell division proteins in the context of Rhizobium's polar growth pattern.

How can researchers address challenges in detecting subtle phenotypes in mtgA deletion mutants?

Given the redundant nature of mtgA function in standard conditions, researchers should employ these strategies to uncover subtle phenotypes:

  • Enhanced microscopy approaches:

    • Super-resolution microscopy (STORM, PALM) to detect nanoscale cell wall irregularities

    • Time-lapse microscopy with phase-contrast and fluorescence to observe growth dynamics

    • Electron microscopy to examine ultrastructural peptidoglycan organization

    • Atomic force microscopy to assess cell surface topography and rigidity

  • Specialized growth conditions:

    • Osmotic stress challenges (varying NaCl concentrations)

    • Carbon source limitations

    • Cell wall-targeting antibiotic exposure at sub-lethal concentrations

    • Temperature fluctuations to stress cell envelope integrity

    • Stationary phase survival assessment

  • Synthetic genetic approaches:

    • Construction of double mutants with other non-essential peptidoglycan synthesis genes

    • Depletion of essential cell wall enzymes in mtgA-null background

    • Overexpression of mtgA to identify gain-of-function phenotypes

  • Cell wall analysis methods:

    • Muropeptide analysis using HPLC and mass spectrometry to detect compositional changes

    • Peptidoglycan isolation and chemical analysis

    • Incorporation assays using radiolabeled or fluorescent precursors

    • Cell wall mechanical strength measurements

These approaches can reveal condition-specific functions that might be masked by redundancy under standard laboratory conditions.

What are the best practices for studying the interaction between mtgA and plant host factors during symbiosis?

Investigating mtgA-host interactions during symbiosis requires specialized approaches:

  • Symbiosis establishment assays:

    • Quantitative nodulation assays comparing wild-type and mtgA mutant strains

    • Competitive index determination when co-inoculating both strains

    • Root attachment and colonization quantification

    • Infection thread formation and progression tracking

  • Molecular interaction studies:

    • Yeast two-hybrid screening using mtgA against plant protein libraries

    • Pull-down assays using tagged mtgA protein

    • Surface plasmon resonance with purified components

    • BiFC (Bimolecular Fluorescence Complementation) in plant cells

  • Imaging approaches:

    • Confocal microscopy with fluorescently tagged mtgA during infection

    • Electron microscopy of the bacteroid-plant interface

    • Use of fluorescent D-amino acid dipeptide (FDAAD) probes to track peptidoglycan synthesis during symbiosis

    • Live-cell imaging during infection thread formation

  • Host response assessment:

    • Transcriptomic analysis of plant cells exposed to wild-type vs. mtgA mutant bacteria

    • Measurement of plant defense response markers

    • Metabolomic analysis of infected plant tissues

    • Calcium signaling visualization during early symbiotic interactions

  • Data integration framework:

    • Multi-omics data integration (bacterial transcriptomics, plant transcriptomics, metabolomics)

    • Temporal analysis across symbiosis stages

    • Network modeling of plant-microbe interactions

    • Comparative analysis across different legume hosts

These approaches can help determine whether mtgA plays a role in the 603 genetic regions identified as important for competitive nodulation and nitrogen fixation in Rhizobium-legume symbiosis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.