Recombinant Rhizobium leguminosarum bv. trifolii NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
nuoK; Rleg2_1271; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Target Names
nuoK
Target Protein Sequence
MVIGLSHYLTVSAILFTLGVFGIFLNRKNVIVILMSVELILLAVNINMVAFSSFLNDIVG QVFALFILTVAAAEAAIGLAILVVFYRNRGSIAVEDVNMMKG
Uniprot No.

Target Background

Function

NDH-1 (NADH-quinone oxidoreductase) facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is the presumed immediate electron acceptor. The enzyme couples this redox reaction to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving energy in a proton gradient.

Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K and its functional significance?

NADH-quinone oxidoreductase (complex I, EC 1.6.5.3) represents the first enzyme in the respiratory chain, catalyzing electron transfer from NADH to quinone coupled with proton pumping across the cytoplasmic membrane . The NuoK subunit specifically is one of seven hydrophobic subunits within the membrane domain of this complex and contains three transmembrane segments (TM1-3) . In Rhizobium leguminosarum, this protein plays a critical role in energy transduction processes that support bacterial metabolism and potentially influences symbiotic interactions with host plants.

The nuoK subunit functions as the bacterial counterpart to the mitochondrial ND4L subunit and contains highly conserved glutamic acid residues positioned in adjacent transmembrane helices that are essential for the energy-coupled activity of the NADH-dehydrogenase complex . Particularly significant is the glutamic acid residue at position 36 in TM2 (KGlu-36), as mutation of this residue to alanine results in complete loss of NDH-1 activities, highlighting its crucial role in the protein's function .

How does the recombinant production of nuoK differ from native expression?

Recombinant production of nuoK involves the creation of synthetic genes that are typically generated from a plasmid or from an integrated sequence in a stable cell line . This approach differs from native expression as it allows for controlled expression in host cells with the specific aim of altering the material properties and achieving translational modifications that enhance protein functionality or facilitate purification and study .

The recombinant technology employs genetic engineering techniques that use enzymes and various laboratory procedures to isolate and manipulate the nuoK genetic material . For example, the gene encoding nuoK can be cloned into an expression vector containing elements such as a T7 promoter and a 6x-His tag, facilitating both controlled expression and subsequent purification . Expression is typically conducted in specialized bacterial strains such as E. coli BL21(DE3), with induction via IPTG to promote protein overproduction .

What experimental designs are most appropriate for studying recombinant nuoK function?

When investigating the function of recombinant nuoK, researchers should carefully consider whether their research questions require experimental or non-experimental designs. Experimental designs are optimal when establishing causality between variables, particularly when examining how modifications to the nuoK protein affect its function and activity .

An effective experimental design for studying recombinant nuoK typically incorporates:

  • Random assignment (R) of experimental units when testing different protein variants

  • Control groups expressing either wild-type nuoK or containing empty vectors

  • Multiple observations (O) across different time points

  • Clearly defined treatments (X) such as site-directed mutagenesis of conserved residues

This can be visually represented using research design notation:

R O₁ X O₂ (experimental group)
R O₁ - O₂ (control group)

Where observations might measure enzyme activity, protein-protein interactions, or symbiotic capabilities .

For studies where causality is not the primary goal, non-experimental designs that focus on gathering descriptive information about nuoK structure or expression patterns may be more appropriate and resource-efficient .

What protein purification methods are most effective for recombinant nuoK?

Based on established protocols for similar membrane proteins, the most effective purification strategy for recombinant nuoK from Rhizobium leguminosarum would employ affinity chromatography leveraging the introduced histidine tag. A typical protocol would involve:

  • Bacterial cell culture growth at 37°C in appropriate media (such as 2TY medium with appropriate antibiotics)

  • Induction of protein expression using IPTG (0.1 mM final concentration)

  • Cell harvesting after 6 hours of post-induction growth

  • Cell lysis via mechanical disruption or detergent-based methods

  • Membrane fraction isolation through differential centrifugation

  • Solubilization of membrane proteins using appropriate detergents

  • Ni-NTA affinity chromatography leveraging the His-tag

  • Size exclusion chromatography for final purification

For membrane proteins like nuoK, special consideration must be given to maintaining protein stability throughout the purification process, potentially requiring the constant presence of detergents or lipid nanodiscs to preserve native-like structure.

How do mutations in conserved residues affect nuoK function?

Studies on equivalent NuoK subunits provide valuable insights into how mutations in conserved residues affect protein function. The table below summarizes the effects of various mutations on enzyme activities:

MutationdNADH-O₂dNADH-DBdNADH-UQ₁dNADH-K₃Fe(CN)₆Cap-40 IC₅₀
Wild Type100 ± 6%100 ± 1%100 ± 0%100 ± 1%0.05
NuoK-KO2 ± 0%3 ± 1%5 ± 2%14 ± 2%-
E36A3 ± 0%5 ± 0%7 ± 2%86 ± 2%-
E72A52 ± 1%54 ± 1%47 ± 9%105 ± 14%0.04
E36A/L32E52 ± 1%57 ± 1%56 ± 5%101 ± 5%0.05
E36A/M38E69 ± 1%68 ± 2%65 ± 7%87 ± 4%0.14
E36A/I39E75 ± 2%49 ± 0%60 ± 7%101 ± 2%0.08
E36A/N40E47 ± 6%57 ± 3%77 ± 3%78 ± 1%0.03

These data demonstrate that mutation of the highly conserved glutamic acid residue at position 36 to alanine (E36A) leads to almost complete loss of enzymatic activity in multiple assays, while mutation of the glutamic acid at position 72 (E72A) produces a more moderate reduction in activity . Interestingly, the detrimental effects of the E36A mutation can be partially rescued by introducing glutamic acid residues at nearby positions (32, 38, 39, or 40), suggesting these positions can functionally substitute for the native E36 when they are located in the same helical phase or turn .

When applying these findings to Rhizobium leguminosarum bv. trifolii nuoK, researchers should consider that while the core structure and functional residues are likely conserved, species-specific variations may influence the exact functional impact of equivalent mutations.

What techniques are appropriate for assessing nuoK activity in recombinant systems?

Multiple complementary techniques should be employed to comprehensively evaluate nuoK activity in recombinant systems:

  • Enzymatic activity assays - Measure electron transfer from NADH to various electron acceptors including oxygen (dNADH-O₂), decylubiquinone (dNADH-DB), ubiquinone-1 (dNADH-UQ₁), and potassium ferricyanide (dNADH-K₃Fe(CN)₆)

  • Inhibitor sensitivity tests - Determine IC₅₀ values for specific inhibitors such as capsaicin (Cap-40) to assess functional integrity of the complex

  • Membrane potential measurements - Evaluate proton pumping efficiency using fluorescent dyes sensitive to membrane potential changes

  • Protein-protein interaction analyses - Employ techniques such as blue native PAGE, crosslinking studies, or co-immunoprecipitation to assess proper complex assembly

  • In vivo functional complementation - Test whether the recombinant nuoK can restore function in knockout mutants, particularly in contexts relevant to symbiotic nitrogen fixation

These methodological approaches provide a comprehensive evaluation of both the biochemical activity and biological function of the recombinant protein.

How might nuoK function relate to symbiotic interactions in Rhizobium-legume systems?

The potential role of nuoK in Rhizobium-legume symbiosis can be inferred from studies on related proteins in Rhizobium leguminosarum. For instance, RopB protein in R. leguminosarum bv. viciae has been shown to form amyloid fibrils at the cell surface, connecting amyloid formation with host-symbiont interactions . When examining bacteroids (the symbiotic form of rhizobia) extracted from pea nodules, researchers observed fibrillar structures containing RopB at the bacteroid surface .

Similar methodological approaches could be applied to investigate nuoK function in symbiotic contexts:

  • Extract bacteroids from nodules of plants inoculated with wild-type and nuoK-mutant strains

  • Compare differentiation status and nitrogen fixation capacity between wild-type and mutant bacteroids

  • Employ transmission immunoelectron microscopy with anti-nuoK antibodies to visualize protein localization

  • Analyze protein expression patterns at different stages of symbiosis development

Interestingly, research on RopB showed differences in protein expression and amyloid formation between differentiated bacteroids from effective (nitrogen-fixing) nodules and undifferentiated bacteroids from ineffective nodules . This suggests that the regulation of certain bacterial proteins is intimately connected with symbiotic development, a principle that may extend to nuoK function.

What bioinformatic approaches can predict functional motifs in nuoK across Rhizobium species?

Advanced bioinformatic analyses can identify functional motifs and predict structure-function relationships in nuoK proteins:

  • Multiple sequence alignment (MSA) - Align nuoK sequences from diverse Rhizobium species to identify conserved residues likely critical for function, with particular attention to transmembrane segments and conserved charged residues

  • Homology modeling - Generate structural models based on solved structures of homologous proteins, such as the nuoK/ND4L components of respiratory complex I from model organisms

  • Molecular dynamics simulations - Predict how mutations influence protein stability, conformation, and interactions with other subunits

  • Evolutionary trace analysis - Identify functionally important residues based on their evolutionary conservation patterns across different clades of nitrogen-fixing bacteria

  • Protein-protein interaction prediction - Identify potential interaction partners within the NADH-quinone oxidoreductase complex and other cellular components

These bioinformatic approaches should be complemented with experimental validation to confirm predicted functional motifs and their biological significance.

How does nuoK contribute to energy homeostasis during symbiotic nitrogen fixation?

The NADH-quinone oxidoreductase complex, including the nuoK subunit, plays a crucial role in energy metabolism by coupling electron transfer to proton translocation . In the context of symbiotic nitrogen fixation, this function takes on particular significance as nitrogen fixation is an energetically demanding process requiring substantial ATP generation.

A comprehensive research approach to understand nuoK's contribution to energy homeostasis during symbiosis should include:

  • Comparative analyses of wild-type and nuoK-mutant strains for:

    • ATP/ADP ratios within bacteroids

    • Membrane potential measurements

    • Respiratory rates under microaerobic conditions typical of nodules

    • Nitrogen fixation efficiency (acetylene reduction assay)

  • Transcriptomic and proteomic profiling to identify compensatory mechanisms activated in response to nuoK mutations

  • Metabolomic analyses to trace carbon flow and energy utilization patterns

The critical role of transmembrane glutamic acid residues in nuoK function, as demonstrated in related systems, suggests these residues may be directly involved in proton translocation mechanisms that generate the proton motive force necessary for ATP synthesis . Understanding how these mechanisms operate within the unique environment of legume nodules could provide fundamental insights into bacterial adaptation to symbiotic lifestyles.

What cross-disciplinary techniques can advance recombinant nuoK research?

Advancing recombinant nuoK research requires integration of techniques from diverse scientific disciplines:

  • Structural biology approaches - Cryo-electron microscopy and X-ray crystallography to resolve the structure of nuoK within the larger NADH-quinone oxidoreductase complex

  • Advanced imaging techniques - Super-resolution microscopy and correlative light and electron microscopy (CLEM) to visualize nuoK localization and dynamics in living cells

  • Systems biology integration - Multi-omics approaches combining transcriptomics, proteomics, and metabolomics to understand nuoK function in the context of whole-cell physiology

  • Synthetic biology applications - Designer protein approaches to create nuoK variants with enhanced or modified functions

  • Plant-microbe interaction methodologies - Dual transcriptomics and proteomics of both plant and bacterial partners during symbiosis establishment and maintenance

These interdisciplinary approaches can help bridge the gap between molecular mechanisms and ecological functions of nuoK in the context of sustainable agriculture and plant-microbe interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.