Recombinant Rhizobium leguminosarum bv. trifolii UPF0283 membrane protein Rleg2_1967 (Rleg2_1967)
Shipped with Ice Packs 
In Stock 
Description
Overview of Recombinant Rhizobium leguminosarum bv. trifolii UPF0283 Membrane Protein Rleg2_1967 (Rleg2_1967)
Rhizobium leguminosarum bv. trifolii UPF0283 membrane protein Rleg2_1967, also referred to as Rleg2_1967, is a protein that, when produced recombinantly, is used in life science research . R. leguminosarum bv. trifolii establishes symbiotic relationships with plants of the Trifolium genus, also known as clover .
Basic Information
Function and Interactions
Rleg2_1967 has multiple biochemical functions, some of which are performed in cooperation with other proteins, while others are carried out by Rleg2_1967 alone . Rleg2_1967 interacts directly with other proteins and molecules, as confirmed through methods like yeast two-hybrid assays, co-immunoprecipitation (co-IP), and pull-down assays .
Product Specs
Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request and incurs an additional charge. Please contact us in advance to arrange this.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request and incurs an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we can prioritize the development of a specific tag if requested. Please specify your required tag type in advance.
Note: While the tag type is determined during production, we can prioritize the development of a specific tag if requested. Please specify your required tag type in advance.
Synonyms
Rleg2_1967; UPF0283 membrane protein Rleg2_1967
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Target Names
Rleg2_1967
Target Protein Sequence
MSKPPSDPPRRPPAAFTYEDEATERHDNGRQAERRRKPESFSENIVVTADEDDPFLNPDK
DLSAVPVATPLRRRTSFGKIAAGAFGILLSLGIGLWTDSLIRDLFTRADWLGYLALAVLA
VGVLAVLALVIRETSGMMRLAAVQAIKAEAEAAMVETRPAKARAVVARLVTLLSANPETS
KGRATLKATEGEVIDPPHLIALAERELLTPLDRKARALIVNASKRVSLVTAVSPRAVVDL
LYVLYEAVRLIRAMAELYGGRPGTLGMFRLLRDVLAHLAVTGSIAVGDSLVQQVLGHGLA
SKLSARLGEGVINGLMTARIGIAAMDLCRPLAFHALKRPGIGDFIGDLTPSMSPRGNTP
Uniprot No.
Target Background
Database Links
KEGG: rlt:Rleg2_1967
STRING: 395492.Rleg2_1967
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
