Recombinant Rhizobium leguminosarum bv. viciae ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Functional Role in ATP Synthase

ATP synthase subunit a is a core component of the F₀ sector, responsible for proton translocation across membranes. In R. leguminosarum, this subunit facilitates energy production during symbiotic nitrogen fixation by coupling ATP synthesis to proton motive force . Key functional insights include:

  • Proton Translocation: Subunit a forms part of the proton channel, enabling the rotation of the F₀F₁ complex to drive ATP synthesis .

  • Conserved Domains: Shares structural motifs with ATP synthase subunits in other bacteria, myosin, and kinases, highlighting evolutionary conservation of energy metabolism mechanisms .

Research Applications

This recombinant protein is primarily used in:

  1. Immunoassays: ELISA kits detect atpB-specific antibodies, aiding studies on rhizobial protein interactions and symbiosis .

  2. Structural Studies: His-tagged purification enables crystallography or cryo-EM analysis to elucidate subunit a’s role in proton translocation .

  3. Symbiosis Research: While not directly studied, insights into ATP synthase function inform investigations into energy metabolism in nitrogen-fixing nodules .

Table 2: ELISA Applications

ApplicationUtility
Antibody DetectionQuantifies atpB-specific immune responses
Protein PurificationValidating His-tagged recombinant protein
Cross-Reactivity StudiesIdentifying conserved epitopes among rhizobia

Comparative Analysis with Native ATP Synthase

The recombinant atpB retains critical functional domains of the native protein, including:

  • Membrane-Spanning Regions: α-helical domains for embedding in lipid bilayers .

  • Proton Channel Residues: Conserved glutamic acid and arginine residues critical for proton binding and translocation .

Key Research Findings

  • Symbiotic Energy Metabolism: ATP synthase activity is essential for maintaining redox balance during nitrogen fixation, as disruptions in related enzymes (e.g., glutathione peroxidase) impair nodule function .

  • Structural Flexibility: Subunit a’s conserved domains suggest a dynamic role in F₀F₁ rotation, aligning with its function in energy coupling .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery times may vary based on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; RL0925; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Rhizobium leguminosarum bv. viciae (strain 3841)
Target Names
atpB
Target Protein Sequence
MSSDPTHQFLIQKIVPIEIGGIDFSFTNASLFMAASAAIAAGFLYFATSNRAIVPGRSQS VAEIFYEFIAKMLTEGAGKQGMQFFPLVFSLFMFVLTANLLGMFPYFFTVTSQIIVTAAL AILVIGTVVVYGFYKHGFKFLNVFVPSGVPGILLPLVVTIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVASLGALGAVGVGGAVLPLIMTVALTGLEFLVAFLQAYVFAVLTCMY LNDAIHPGGH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel. It directly participates in the translocation of protons across the membrane.
Database Links

KEGG: rle:RL0925

STRING: 216596.RL0925

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a (atpB) in Rhizobium leguminosarum bv. viciae?

ATP synthase subunit a, encoded by the atpB gene (locus RL0925) in Rhizobium leguminosarum bv. viciae strain 3841, is a critical component of the F0 sector of bacterial ATP synthase. This membrane-embedded protein (UniProt accession: Q1MKT2) consists of 250 amino acids and plays an essential role in proton translocation across the membrane, which drives the synthesis of ATP. The protein functions within the complete ATP synthase complex (F1F0-ATPase) that couples the proton gradient to ATP synthesis in these nitrogen-fixing bacteria. The subunit a forms part of the membrane-embedded proton channel in conjunction with other F0 subunits, particularly creating the pathway for proton movement that enables the rotational catalysis mechanism of ATP synthesis .

How does Rhizobium leguminosarum ATP synthase differ from other bacterial ATP synthases?

Rhizobium leguminosarum ATP synthase belongs to the ATP synthase family found in α-proteobacteria, which shows distinct evolutionary characteristics compared to other bacterial groups. The key differences lie in the regulatory subunits and their functions. While most bacterial ATP synthases use the ε subunit as the primary inhibitory component, α-proteobacteria, including Rhizobium species, have evolved a different regulatory mechanism involving the transfer of inhibitory function from the ε subunit to the ζ subunit. This represents a significant evolutionary adaptation that distinguishes α-proteobacterial ATP synthases from other bacterial ATP synthases .

The atpB gene product in R. leguminosarum maintains structural conservation across α-proteobacteria but exhibits species-specific adaptations related to its lifestyle as a plant symbiont. These adaptations may reflect the energy requirements during free-living versus symbiotic states, as seen in comparative studies with other α-proteobacteria such as Paracoccus denitrificans and Rhodobacter species .

Why is recombinant atpB important for studying Rhizobium leguminosarum function?

Recombinant atpB provides researchers with a purified protein component that enables detailed investigation of ATP synthase structure and function in R. leguminosarum without the complexities of whole-cell systems. This approach is critical for several research applications:

  • Structure-function relationship studies: Recombinant atpB allows researchers to perform site-directed mutagenesis to identify critical residues involved in proton translocation and interaction with other ATP synthase subunits.

  • Bioenergetic analysis: Isolated recombinant protein enables the study of proton translocation mechanisms specific to R. leguminosarum, which may differ from other bacterial systems based on its symbiotic lifestyle.

  • Antibody production: Purified recombinant protein serves as an antigen for generating specific antibodies used in protein localization and quantification studies .

  • Reconstitution experiments: Recombinant atpB can be used in reconstitution studies with other ATP synthase components to understand assembly and function of the complete enzyme complex, similar to approaches used with other α-proteobacterial ATP synthases .

What are the optimal conditions for expressing recombinant R. leguminosarum atpB in heterologous systems?

Expression of recombinant R. leguminosarum atpB requires careful optimization due to its membrane protein nature. Based on approaches used for similar α-proteobacterial ATP synthase subunits, the following methodology is recommended:

Expression System Selection:

  • E. coli BL21(DE3) or C41(DE3) strains are preferred for membrane protein expression

  • Vector systems with tightly controlled promoters (e.g., pET or pBAD) minimize toxicity

  • Fusion tags (e.g., His6, MBP) improve solubility and facilitate purification

Optimized Expression Protocol:

  • Transform expression plasmid into selected E. coli strain

  • Culture cells at 37°C until OD600 reaches 0.6-0.8

  • Reduce temperature to 18-20°C before induction

  • Induce with low concentrations of inducer (0.1-0.5 mM IPTG or 0.002-0.02% arabinose)

  • Continue expression for 16-20 hours at reduced temperature

  • Harvest cells by centrifugation (6,000 × g, 10 minutes, 4°C)

Membrane Protein Solubilization:

  • Resuspend cells in buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl

  • Disrupt cells using sonication or cell disruptor

  • Separate membrane fraction by ultracentrifugation (100,000 × g, 1 hour, 4°C)

  • Solubilize membranes using mild detergents (DDM, LDAO, or C12E8) at concentrations just above CMC

This methodology draws from approaches successfully applied to other α-proteobacterial ATP synthase components and can be adapted specifically for R. leguminosarum atpB expression .

How can I confirm the structural integrity of purified recombinant atpB protein?

Confirming structural integrity of purified recombinant atpB requires a multi-method approach:

Protein Purity Assessment:

  • SDS-PAGE analysis showing a single band at the expected molecular weight (~27 kDa)

  • Western blot using anti-atpB antibodies for specific detection

  • Mass spectrometry for accurate mass determination and sequence coverage analysis

Secondary Structure Analysis:

  • Circular Dichroism (CD) spectroscopy to verify α-helical content characteristic of ATP synthase subunit a

  • Fourier Transform Infrared Spectroscopy (FTIR) to assess secondary structure elements

Tertiary Structure Assessment:

  • Limited proteolysis to verify correct folding (properly folded membrane proteins show characteristic proteolysis patterns)

  • Fluorescence spectroscopy using intrinsic tryptophan fluorescence to assess tertiary structure

  • Thermal shift assays to determine protein stability

Functional Assessment:

  • Reconstitution into liposomes to measure proton transport activity

  • Co-purification assays with other ATP synthase subunits to verify interaction capability

  • ATP hydrolysis inhibition assays when combined with other ATP synthase components

These methods collectively provide a comprehensive assessment of whether the recombinant atpB protein maintains its native structure after purification, which is critical before proceeding with functional studies.

What reconstitution systems best mimic the native environment for functional studies of atpB?

For functional studies of recombinant atpB, the following reconstitution systems can effectively mimic the native membrane environment:

Proteoliposome Reconstitution:

  • Preparation of liposomes from E. coli polar lipids or synthetic phospholipids (POPC:POPE:POPG at 7:2:1 ratio)

  • Detergent-mediated incorporation of purified atpB (detergent:lipid ratio of 2:1)

  • Detergent removal by Bio-Beads SM-2 or dialysis

  • Verification of incorporation by freeze-fracture electron microscopy

Nanodiscs System:

  • Assembly of nanodiscs containing atpB using MSP1D1 scaffold protein

  • Lipid composition optimization (POPE:POPG at 3:1 ratio) to match bacterial membranes

  • Size-exclusion chromatography purification of atpB-containing nanodiscs

  • Verification using negative-stain electron microscopy

Co-reconstitution with Other ATP Synthase Subunits:

  • Preparation of mixed micelles containing purified atpB and other F0 subunits

  • Stepwise reconstitution with addition of F1 subunits

  • Functional assessment through ATP synthesis or hydrolysis assays

  • Proton pumping assessment using pH-sensitive fluorescent dyes (ACMA)

Comparative Reconstitution Efficiency:

Reconstitution MethodProtein:Lipid RatioOrientation ControlFunctional ActivityStability
Proteoliposomes1:100 to 1:50 (w/w)60-70% correct40-60% of native1-2 weeks at 4°C
Nanodiscs1:60 (w/w)>90% correct70-80% of native2-4 weeks at 4°C
Co-reconstitutionVaries by subunit50-70% correct30-50% of native1 week at 4°C

These reconstitution systems have been successfully applied to similar membrane proteins from α-proteobacteria and can be optimized specifically for R. leguminosarum atpB .

How does the inhibitory mechanism of ATP synthase in R. leguminosarum compare to other α-proteobacteria?

The ATP synthase inhibitory mechanism in R. leguminosarum, like other α-proteobacteria, represents a fascinating evolutionary adaptation that differs from the canonical bacterial model. Based on comparative studies with related organisms, the following differences are evident:

Structural Basis for Inhibition:
The ζ subunit in α-proteobacteria contains an N-terminal inhibitory region that can adopt either a compact non-inhibitory conformation or an extended α-helical inhibitory conformation. This conformational switch is crucial for regulating ATP synthase activity. The specific conformation of the R. leguminosarum ζ subunit likely depends on cellular energy status and environmental conditions relevant to its symbiotic lifestyle .

Comparative Inhibitory Potency:
Studies with related α-proteobacteria show significant variation in inhibitory potency of the ζ subunit:

SpeciesLifestyleζ Subunit appIC50 ValueInhibitory Capacity
P. denitrificansFree-living0.44-0.55 μMHigh
Jannaschia sp.Free-living marine1.12 μM (heterologous)High
R. capsulatusPhotosyntheticNot determinedPresumed high
S. melilotiSymbioticDiminishedLow

R. leguminosarum, as a facultative symbiont, likely exhibits intermediate inhibitory capacity between the free-living and obligate symbiotic α-proteobacteria. This reflects its adaptation to both soil environments and plant symbiosis, requiring different levels of ATP synthesis regulation depending on its current lifestyle phase .

What role does atpB play in the energetics of Rhizobium leguminosarum during symbiotic nitrogen fixation?

The atpB gene product plays a crucial yet complex role in R. leguminosarum energetics during symbiotic nitrogen fixation, balancing several bioenergetic demands:

Microaerobic Adaptation:
During nodule formation, rhizobia experience a transition to microaerobic conditions. The atpB subunit's proton channel characteristics must maintain efficient ATP synthesis under low oxygen tension. This requires fine-tuned proton translocation efficiency that may differ from free-living conditions, potentially involving structural adaptations in the a-subunit's proton path .

pH Adaptation:
Symbiotic rhizobia must function across pH gradients between the plant cytoplasm and symbiosome space. The atpB subunit contains critical residues that interact with protons during translocation, and these must maintain functionality across varying pH environments encountered during infection thread formation and bacteroid development. The protein's sequence contains conserved residues (particularly in the transmembrane domains) that are likely crucial for this pH adaptation .

Integration with Carbon Metabolism:
During symbiosis, rhizobia shift their carbon metabolism to efficiently utilize plant-derived carbon sources. The ATP synthase complex, including the atpB subunit, must functionally couple with these altered metabolic pathways. The regulation of ATP synthase activity during this metabolic shift may involve specific interactions between the a-subunit and regulatory proteins or metabolites that signal the symbiotic state .

This multifaceted role makes atpB a particularly interesting target for understanding the bioenergetic adaptations required for successful rhizobium-legume symbiosis.

How do mutations in the atpB gene affect ATP synthase assembly and function in R. leguminosarum?

Mutations in the atpB gene can have profound effects on ATP synthase assembly and function in R. leguminosarum, with consequences that extend to symbiotic effectiveness. Based on studies of ATP synthase in related bacteria, several predictable effects can be outlined:

Critical Functional Domains:
The atpB gene encodes a protein with several functionally crucial regions:

  • Transmembrane helices forming the proton channel

  • Arginine residue(s) essential for proton translocation (typically in the fourth transmembrane helix)

  • Interface regions interacting with other F0 subunits

  • Regions contributing to the peripheral stator

Mutations in these domains have distinct consequences:

Domain TypeMutation EffectFunctional ConsequenceComplementation Possibility
Proton path residuesDisrupts proton translocationSevere loss of ATP synthesisDifficult, requires exact residue restoration
Transmembrane helicesDisrupts membrane integrationComplete loss of functionPossible with conservative substitutions
Subunit interfacesImpairs complex assemblyUnstable ATP synthase complexPossible with structurally similar mutations
Peripheral regionsReduces stabilityPartial function retentionReadily complemented

Phenotypic Consequences:
Mutations in atpB typically manifest as:

  • Growth deficiencies in energy-limited conditions

  • Impaired survival during pH stress

  • Reduced competitiveness in soil environments

  • Diminished symbiotic effectiveness (delayed nodulation, incomplete bacteroid differentiation)

Suppressor Mutations:
Interestingly, the bacterial ATP synthase complex demonstrates remarkable adaptability. Certain deleterious mutations in atpB can be partially compensated by secondary mutations in:

  • Other ATP synthase subunits (particularly b and c subunits)

  • Components of the electron transport chain

  • Metabolic enzymes that affect the proton motive force

This adaptability reflects the essential nature of ATP synthesis and the evolutionary pressure to maintain this function, even under genetic perturbation .

How can researchers differentiate between effects on ATP synthesis versus hydrolysis when studying atpB mutations?

Differentiating between effects on ATP synthesis versus hydrolysis when studying atpB mutations requires specialized experimental approaches that isolate these opposing functionalities:

In Vitro Differentiation Methods:

  • Inside-Out Vesicle Preparation:

    • Prepare inside-out membrane vesicles from R. leguminosarum cells

    • For synthesis measurement: Energize vesicles with NADH or succinate to generate proton gradient

    • For hydrolysis measurement: Add ATP directly and measure Pi release

    • Compare ratios of synthesis to hydrolysis activities between wild-type and mutant atpB

  • Reconstituted Proteoliposome Assays:

    • Reconstitute purified ATP synthase containing wild-type or mutant atpB into liposomes

    • For synthesis: Establish artificial pH gradient (acidic outside) and measure ATP production

    • For hydrolysis: Add ATP and measure proton pumping using ACMA fluorescence quenching

    • Calculate synthesis/hydrolysis ratio to identify synthesis-specific defects

In Vivo Differentiation Approaches:

  • Metabolic Labeling:

    • Pulse-label cells with 32P-orthophosphate

    • Compare rates of ATP formation under different conditions

    • Synthesis-specific defects show reduced labeling despite normal hydrolysis activity

  • Growth Condition Manipulation:

    • Compare growth in fermentable versus non-fermentable carbon sources

    • Mutations affecting only synthesis show normal growth on fermentable substrates but fail on substrates requiring oxidative phosphorylation

    • Mutations affecting both functions show growth defects in all conditions

Analytical Framework for Interpretation:

ParameterSynthesis-Specific DefectHydrolysis-Specific DefectBoth Functions Affected
ATP synthesis rateSeverely reducedNormal or slightly reducedSeverely reduced
ATP hydrolysis rateNormalSeverely reducedSeverely reduced
Proton translocationUnidirectionally impairedUnidirectionally impairedImpaired in both directions
pH dependencyAbnormal synthesis pH profileNormal synthesis pH profileAbnormal profiles for both
Inhibitor sensitivityNormal sensitivity to hydrolysis inhibitorsAltered sensitivity to hydrolysis inhibitorsAltered sensitivity patterns

This systematic approach enables researchers to precisely characterize the functional impact of atpB mutations on the distinct but related processes of ATP synthesis and hydrolysis .

What bioinformatic approaches are most effective for analyzing evolutionary conservation of atpB across rhizobial species?

To effectively analyze evolutionary conservation of atpB across rhizobial species, researchers should implement a multi-level bioinformatic approach that captures both sequence and structural conservation patterns:

Sequence-Based Conservation Analysis:

  • Multiple Sequence Alignment (MSA) Optimization:

    • Collect atpB sequences from diverse rhizobial species and related α-proteobacteria

    • Use MAFFT or T-Coffee algorithms with iterative refinement options

    • Apply structure-aware alignment parameters for transmembrane proteins

    • Generate conservation scores using methods like Jensen-Shannon divergence

  • Evolutionary Rate Analysis:

    • Calculate site-specific evolutionary rates using maximum likelihood methods

    • Identify sites under positive or purifying selection using PAML or HyPhy

    • Compare evolutionary rates between free-living and symbiotic rhizobia

    • Correlate evolutionary rates with functional domains

Structure-Informed Conservation Mapping:

  • Structure Prediction and Validation:

    • Generate AlphaFold2 models for atpB from multiple rhizobial species

    • Validate models using ProQ3 or MolProbity

    • Compare predicted structures to available experimental structures from related species

  • Conservation Visualization:

    • Map sequence conservation onto 3D structural models

    • Analyze conservation patterns in context of:

      • Proton channel residues

      • Subunit interaction interfaces

      • Transmembrane domain packing

Comparative Analysis Framework:

Conservation ParameterHighly Conserved RegionsVariable RegionsInterpretation
Sequence identity>80% across α-proteobacteria<50% between distantly related speciesCore functional residues vs. adaptable regions
Structural RMSD<1.5 Å>3 ÅStructurally constrained vs. flexible regions
Evolutionary rate (dN/dS)<0.1 (purifying selection)>1 (positive selection)Functional constraint vs. adaptive evolution
Coevolution signalStrong coevolution with other ATP synthase subunitsWeak coevolutionInterface integrity maintenance

Rhizobial-Specific Adaptation Identification:

Particular attention should be paid to:

  • Residues uniquely conserved in symbiotic rhizobia but not free-living α-proteobacteria

  • Correlation between conservation patterns and symbiotic effectiveness

  • Identification of residues under lineage-specific selection in different rhizobial clades

This comprehensive approach has successfully revealed evolutionary patterns in other membrane proteins from α-proteobacteria and can provide insight into how atpB has adapted to the symbiotic lifestyle in Rhizobium leguminosarum .

How can researchers correlate atpB structure-function with symbiotic efficiency in Rhizobium-legume interactions?

Correlating atpB structure-function with symbiotic efficiency requires an integrated approach that connects molecular mechanisms to plant-level phenotypes:

Structure-Function Mapping Methodology:

  • Site-Directed Mutagenesis Strategy:

    • Target conserved residues identified through bioinformatic analysis

    • Create a mutation series spanning the proton channel, stator contacts, and regulatory regions

    • Generate complementation constructs with mutations in the R. leguminosarum atpB gene

    • Introduce constructs into atpB-deficient strains via homologous recombination

  • Biochemical Characterization:

    • Measure ATP synthesis/hydrolysis activities in membrane preparations

    • Determine proton translocation efficiency using fluorescent probes

    • Assess ATP synthase assembly and stability via BN-PAGE

    • Quantify protein expression levels through western blotting

Symbiotic Phenotype Assessment:

  • Plant Inoculation Experiments:

    • Inoculate host legumes (e.g., pea plants) with R. leguminosarum strains carrying atpB mutations

    • Measure nodulation efficiency, timing, and nodule morphology

    • Quantify nitrogenase activity via acetylene reduction assay

    • Assess plant growth parameters and nitrogen content

  • Bacteroid Analysis:

    • Isolate bacteroids from nodules

    • Measure ATP content and energy charge

    • Assess membrane potential using fluorescent dyes

    • Quantify bacteroid differentiation markers

Correlation Analysis Framework:

ATP Synthase ParameterMeasurement MethodSymbiotic ParameterStatistical Approach
ATP synthesis rateLuciferase assayNitrogenase activityPearson correlation
Proton translocation efficiencyACMA fluorescenceNodule development timingRegression analysis
ATP synthase stabilityBN-PAGEBacteroid persistenceSurvival curve comparison
pH optimumpH-dependent activityInfection successLogistic regression

Integrative Analytical Approaches:

  • Multi-Parameter Correlation:

    • Principal Component Analysis to identify key parameters driving symbiotic variation

    • Hierarchical clustering to group mutations by phenotypic similarity

    • Path analysis to establish causal relationships between ATP synthase function and symbiotic outcomes

  • Environmental Interaction Assessment:

    • Test symbiotic performance under varying soil pH conditions

    • Evaluate effects of carbon limitation on ATP synthase mutants' symbiotic capacity

    • Assess competitive ability against wild-type strains in co-inoculation experiments

This comprehensive approach provides a framework for connecting specific molecular features of the atpB-encoded protein to the complex phenotype of symbiotic nitrogen fixation, revealing how energy metabolism adaptations in R. leguminosarum contribute to its successful mutualism with legume hosts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.