Recombinant Rhizobium leguminosarum bv. viciae ATP synthase subunit b/b' (atpG)

Shipped with Ice Packs
In Stock

Description

Introduction

Rhizobium leguminosarum bv. viciae is a bacterium known for its symbiotic relationship with legumes like peas and vetch, where it facilitates nitrogen fixation within root nodules . ATP synthase, a vital enzyme complex, plays a central role in energy production within cells. The subunit b/b' (atpG) is a component of the ATP synthase complex in R. leguminosarum bv. viciae . Understanding the structure, function, and expression of atpG can provide insights into the bacterium's metabolism, symbiotic efficiency, and adaptation to different environmental conditions .

General Information

  • Definition: Recombinant Rhizobium leguminosarum bv. viciae ATP synthase subunit b/b' (atpG) refers to the protein product of the atpG gene, produced using recombinant DNA technology .

  • Function: The atpG gene encodes for the ATP synthase subunit b/b', a component of the F0 sector of the ATP synthase complex . ATP synthase is responsible for producing ATP from ADP, utilizing a proton gradient across the cell membrane .

  • Synonyms: ATP synthase subunit b/b', ATP synthase F(0) sector subunit b/b', ATPase subunit II, F-type ATPase subunit b/b', F-ATPase subunit b/b' .

  • Gene Name: atpG

  • Ordered Locus Names: RL0927

  • Sequence Length: The expressed protein region consists of 207 amino acids .

Structure and Composition

The ATP synthase complex consists of two main parts: F1 and F0. Subunit b/b' (atpG) is a component of the F0 sector, which is embedded in the cell membrane and facilitates proton transport . The F0 sector is linked to the F1 sector, where ATP synthesis occurs. The subunit b/b' is essential for the structural integrity and function of the ATP synthase complex .

Expression and Regulation

The expression of atpG and other ATP synthase genes in R. leguminosarum bv. viciae is influenced by various factors, including carbon source availability and the developmental stage of the bacteria within the symbiotic nodule . Microarray experiments have shown that bacteroid metabolism resembles that of dicarboxylate-grown cells, with induction of dicarboxylate transport, gluconeogenesis, and alanine synthesis, and repression of sugar utilization .

Role in Symbiosis and Nitrogen Fixation

ATP synthase plays a crucial role in providing the energy required for nitrogen fixation in R. leguminosarum bv. viciae bacteroids . Nitrogen fixation is an energy-intensive process, and ATP is required to reduce atmospheric nitrogen into ammonia, which is then assimilated by the host plant. The efficiency of ATP production by ATP synthase directly impacts the amount of nitrogen that can be fixed, thus affecting the symbiotic performance .

Environmental Adaptation

R. leguminosarum bv. viciae can adapt to various environmental stresses, such as temperature and pH variations . For example, certain strains exhibit tolerance to high temperatures and pH levels, which can affect their growth and symbiotic efficiency. The activity and regulation of ATP synthase may be influenced by these environmental factors, although specific data on the atpG subunit's response is limited .

Research and Applications

Recombinant ATP synthase subunit b/b' (atpG) is used in research for various purposes :

  • ELISA assays: Recombinant atpG can be used as an antigen in enzyme-linked immunosorbent assays (ELISA) to detect and quantify antibodies against R. leguminosarum bv. viciae .

  • Structural studies: Recombinant production allows for structural studies to elucidate the detailed structure and function of the ATP synthase complex .

  • Functional analysis: Recombinant atpG can be used to study its interactions with other subunits and its role in proton transport and ATP synthesis .

Tables and Data

Table 1: Growth and survival of Rhizobium leguminosarum bv. viciae strains at different temperatures .

StrainAbsorbance (420 nm) at 28°C (4 DAI)Absorbance (420 nm) at 45°C (4 DAI)Percent growth at 45°C compared to 28°C
N131.457ND*ND
N161.875ND*ND
N242.4731.47659.68
N252.7852.46588.5
N292.5981.46356.31
N302.9752.39880.60
N392.6451.53460.54
N402.9872.87596.25
N422.5271.36457.98

*ND = Not detectable, DAI = Day after incubation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF2; atpG; RL0927; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-207
Protein Length
full length protein
Species
Rhizobium leguminosarum bv. viciae (strain 3841)
Target Names
atpF2
Target Protein Sequence
MFFVTPAYAEEAPAAATGTDAHAAPAAGEVHTETGVAEGGHARGPFPPFDSTTYASQLLW LVITFGVFYLLMQKVIAPRIGAILDQRHTRLSQDVEEAGRLKAEADAAVRTYEGELAAAR AKSNAIGSAARDAAKAKAEQDRRAVEATLSEKIKAAEVRIGEIKAKAFADVGAIAEETAA AVIDQLIGGTVAKADVAAAVAAAKKEV
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism of the central stalk subunits. The b' subunit, a divergent and duplicated form of the b subunit found in plants and photosynthetic bacteria, is a component of the F0 channel and part of the peripheral stalk, connecting F1 and F0.
Database Links

KEGG: rle:RL0927

STRING: 216596.RL0927

Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is ATP synthase subunit b/b' (atpG) in Rhizobium leguminosarum bv. viciae?

ATP synthase subunit b/b' (atpG) is a crucial component of the F-type ATP synthase complex in R. leguminosarum bv. viciae. It forms part of the peripheral stalk in the F0 sector, connecting the membrane-embedded F0 domain to the catalytic F1 sector. Based on structural homology with related Rhizobium species like R. meliloti, the atpG protein consists of approximately 204 amino acids and plays an essential role in maintaining the structural integrity of the ATP synthase complex . The protein contains distinctive membrane-spanning regions in its N-terminal domain and coiled-coil structures in its C-terminal region that facilitate interactions with other ATP synthase subunits.

How does atpG function within the ATP synthase complex?

The atpG protein serves as a critical stator component that prevents rotation of the F1 sector while allowing the central stalk to rotate within it. In R. leguminosarum bv. viciae, this function is particularly important during bacteroid development when energy metabolism shifts significantly to support nitrogen fixation. The protein contains several key functional domains:

  • N-terminal membrane anchor domain that integrates into the bacterial membrane

  • Central region with specific structural properties that contribute to stator rigidity

  • C-terminal domain that interacts with F1 sector subunits

During ATP synthesis, atpG maintains the structural stability of the complex while proton flow through the F0 sector drives rotation of the central stalk, causing conformational changes in the F1 sector that catalyze ATP formation .

What is known about atpG gene organization in Rhizobium species?

The atpG gene in Rhizobium leguminosarum bv. viciae is part of the atp operon that encodes multiple ATP synthase subunits. While specific gene organization isn't detailed in the provided research, comparative genomics suggests that the atp operon structure is relatively conserved across related species. In R. meliloti (Sinorhizobium meliloti), the atpG gene is identified as having the locus tag SMc00869 (R00837) .

Transcriptomic studies indicate that expression of ATP synthase genes, including atpG, changes significantly during bacteroid development and in response to different carbon sources . This suggests sophisticated regulatory mechanisms controlling the expression of atpG and other ATP synthase genes to meet changing energy demands during free-living growth versus symbiotic nitrogen fixation.

What approaches can be used to study atpG function in R. leguminosarum?

Several complementary approaches can be employed to investigate atpG function:

Genetic approaches:

  • Targeted mutagenesis using site-directed techniques

  • Transposon mutagenesis using systems like pSAM_Rl, which has shown high insertion efficiency (83% of potential mariner insertion sites covered) in R. leguminosarum

  • Conditional knockdown systems if atpG proves essential

  • Reporter gene fusions to monitor expression patterns

Biochemical approaches:

  • Recombinant expression and purification of atpG protein

  • Protein-protein interaction studies to identify binding partners

  • ATP synthase activity assays comparing wild-type and mutant strains

  • Structural studies using techniques like X-ray crystallography or cryo-EM

Physiological approaches:

  • Growth characterization under different carbon sources

  • Symbiotic performance analysis in plant infection assays

  • Membrane potential and ATP production measurements

  • Metabolomic profiling to detect metabolic shifts

Transcriptomic analysis has been successfully applied to R. leguminosarum bv. viciae, revealing significant metabolic changes during bacteroid development that likely involve ATP synthase .

How can I clone and express recombinant atpG for functional studies?

A methodological approach for cloning and expressing recombinant atpG involves:

  • Gene amplification:

    • Design primers based on the known R. leguminosarum bv. viciae atpG sequence

    • Amplify the gene using high-fidelity PCR from genomic DNA

    • Consider codon optimization if expressing in a heterologous host

  • Vector selection and cloning:

    • For E. coli expression, pET-series vectors with appropriate tags (His, GST, MBP)

    • For expression in Rhizobium, broad-host-range vectors may be preferable

    • Include appropriate promoters and ribosome binding sites

  • Expression optimization:

    • Test multiple expression conditions (temperature, inducer concentration, time)

    • Consider low-temperature induction to improve protein folding

    • For membrane-associated proteins, specialized strains or solubilization tags may help

  • Purification strategy:

    • Affinity chromatography using tags

    • Ion exchange chromatography

    • Size exclusion chromatography as a final polishing step

  • Storage conditions:

    • Store in Tris-based buffer with 50% glycerol

    • Maintain at -20°C for short-term or -80°C for extended storage

When expressing membrane-associated proteins like atpG, detergents or amphipols may be necessary to maintain stability and solubility during purification.

What transposon mutagenesis approaches work effectively in R. leguminosarum?

Transposon mutagenesis has proven to be a powerful approach for studying gene function in R. leguminosarum. The pSAM_Rl mariner transposon system has been specifically adapted for use in Rhizobiaceae and shows excellent performance:

  • Transposition efficiency:

    • pSAM_Rl yields approximately 2.01 × 10^-4 transposon mutants per recipient cell in R. leguminosarum

    • This is higher than the efficiency observed in related species like A. tumefaciens (8.04 × 10^-5) and S. meliloti (2.54 × 10^-5)

  • Genome coverage:

    • Achieves high insertion density (83% of potential mariner insertion sites) in R. leguminosarum

    • Mean read count per insertion site ranges from 18.6-22.1 across replicons

  • Practical implementation:

    • Conjugation-based delivery from E. coli SM10λpir donor strain

    • Selection using neomycin resistance marker

    • Generates large mutant libraries suitable for high-throughput screening

  • Data analysis:

    • Analysis tools like the Tn-HMM python module can identify genes essential for growth

    • Integration with next-generation sequencing allows genome-wide functional analysis

This approach could be adapted to study atpG function, though care must be taken as energy metabolism genes are often essential for growth.

How does atpG expression change during bacteroid development?

While specific atpG expression patterns aren't directly reported in the search results, transcriptomic analysis of R. leguminosarum bv. viciae during symbiosis provides insights into energy metabolism changes that likely involve ATP synthase:

  • Metabolic shifts during bacteroid development:

    • Bacteroid metabolism resembles dicarboxylate-grown cells with induction of dicarboxylate transport, gluconeogenesis, and alanine synthesis

    • Sugar utilization pathways are repressed in bacteroids

    • The decarboxylating arm of the tricarboxylic acid cycle is highly induced, particularly in early (7-day) nodules

  • Temporal expression patterns:

    • Different metabolic genes show distinct expression patterns at 7, 15, and 21 days post-inoculation

    • Early developmental changes (7 days) involve large shifts in expression of regulators, exported and cell surface molecules, and stress response proteins

    • Nitrogen fixation (fix) genes are induced early but continue to increase in mature bacteroids

  • Carbon source effects:

    • Gene expression varies significantly based on carbon substrate availability

    • These changes likely affect ATP synthase expression to match energy production with changing metabolic demands

Understanding these broader metabolic shifts provides context for investigating specific atpG regulation during symbiosis and bacteroid development.

What structural differences exist between ATP synthase b/b' subunits across Rhizobium species?

Comparative analysis of ATP synthase b/b' subunits between Rhizobium species reveals important structural features:

  • Sequence conservation and variation:

    • The basic architecture is conserved across species, reflecting the fundamental role in ATP synthase function

    • The R. meliloti atpG protein consists of 204 amino acids with the specific sequence: MFVTAAYAQSSTTEGAEAHDAAAAGEVHTETGVAHEADHGAGVFPPFDTTHFASQLLWLAITFGLFYLLMSKVIIPRIGGILETRHDRIAQDLDEASRLKGEADAAIAAYEQELAGARAKGHSIADTAREAAKAKAKADRDGVEAGLAKKIAAAEARIADIKSKALADVGAIAEETATAVVKQLIGGTVTKAEIAAAFKASAGN

    • R. leguminosarum bv. viciae likely has a similar but distinct sequence reflecting evolutionary adaptation

  • Functional domains:

    • N-terminal membrane anchor region: Contains hydrophobic amino acids forming transmembrane domains

    • Central connecting region: Provides structural flexibility while maintaining rigidity

    • C-terminal interaction domain: Contains residues critical for interaction with F1 sector subunits

  • Species-specific adaptations:

    • Differences in specific residues may reflect adaptation to different host plants or environmental niches

    • These variations could influence interaction with other ATP synthase subunits or regulatory proteins

Detailed structural comparisons would require experimental determination through techniques like X-ray crystallography or cryo-electron microscopy.

How does ATP synthase function relate to nitrogen fixation efficiency?

ATP synthase function is intimately connected to nitrogen fixation efficiency in Rhizobium-legume symbiosis:

  • Energy requirements for nitrogen fixation:

    • Nitrogen fixation is an extremely energy-intensive process, requiring 16 ATP molecules to reduce one N₂ molecule

    • ATP synthase is the primary source of ATP during bacteroid metabolism

    • The efficiency of ATP production directly impacts nitrogenase activity

  • Carbon metabolism and energy coupling:

    • Bacteroids primarily use plant-supplied dicarboxylates (malate, succinate) as carbon sources

    • The decarboxylating arm of the TCA cycle is highly induced in bacteroids

    • These metabolic shifts generate the proton gradient that drives ATP synthase

  • Regulatory interactions:

    • Fix genes (required for nitrogen fixation) are induced early in nodule development but continue to increase in mature bacteroids

    • Nif genes (encoding nitrogenase components) are induced strongly in older bacteroids

    • These expression patterns must coordinate with energy production to support nitrogen fixation

Interestingly, mutation studies targeting genes upregulated in mature bacteroids found that none were individually essential for nitrogen fixation, suggesting functional redundancy or complex interdependencies in the symbiotic metabolic network .

How can I resolve issues with atpG protein solubility during recombinant expression?

Membrane-associated proteins like atpG can present significant solubility challenges. Here are methodological approaches to improve solubility:

  • Fusion tag strategies:

    • Use solubility-enhancing tags like MBP (maltose-binding protein), GST, or SUMO

    • Consider dual-tagging approaches (e.g., His-MBP) for improved solubility and purification

    • Test multiple tag positions (N-terminal vs. C-terminal)

  • Expression condition optimization:

    • Reduce expression temperature (16-20°C) to slow protein synthesis and improve folding

    • Test various inducer concentrations to find optimal expression levels

    • Consider auto-induction media for gradual protein expression

  • Solubilization approaches:

    • For membrane-associated regions, include appropriate detergents (DDM, LDAO, etc.)

    • Test different detergent concentrations and types

    • Consider amphipols or nanodiscs for stabilizing membrane proteins

  • Structural modification strategies:

    • Express soluble domains separately if full-length protein is problematic

    • Design construct boundaries based on predicted domain structures

    • Introduce stabilizing mutations based on structural knowledge

  • Specialized expression systems:

    • Use bacterial strains with enhanced membrane protein expression capabilities

    • Consider cell-free expression systems that allow direct addition of solubilizing agents

    • Explore expression in the native organism or closely related species

Storage in Tris-based buffer with 50% glycerol at -20°C or -80°C has been successfully used for similar recombinant proteins from Rhizobium .

What strategies can overcome challenges in generating atpG knockout mutants?

Creating knockout mutants of genes involved in central metabolism, like atpG, often presents challenges due to their potential essentiality. Here are methodological approaches to address these challenges:

  • Conditional knockout strategies:

    • Use inducible promoter systems to control expression

    • Temperature-sensitive constructs that function under permissive conditions

    • Create depletion strains where protein levels gradually decrease

  • Partial function approaches:

    • Target specific domains rather than deleting the entire gene

    • Introduce point mutations in key functional residues

    • Create truncated versions that maintain some but not all functionality

  • Complementation considerations:

    • Maintain a wild-type copy on a plasmid during mutagenesis

    • Use counter-selectable markers to remove complementing plasmids under specific conditions

    • Establish merodiploid strains with both mutant and wild-type copies

  • Technical optimization:

    • For homologous recombination, use longer homology arms (>1kb)

    • Optimize transformation/conjugation conditions

    • For transposon mutagenesis, generate large libraries to capture rare viable mutants

  • Alternative functional genomic approaches:

    • CRISPR interference (CRISPRi) for gene silencing rather than deletion

    • Transposon sequencing (Tn-seq) to identify essential genes

    • Suppressor mutation screening to identify genetic interactions

The pSAM_Rl transposon system has been successfully used in R. leguminosarum with high insertion efficiency, making it a valuable tool for functional genomic screening .

How can I interpret contradictory results between in vitro ATP synthase activity and in vivo phenotypes?

Resolving discrepancies between in vitro biochemical data and in vivo observations requires systematic analysis:

  • Methodological considerations:

    • Ensure in vitro conditions reasonably approximate physiological conditions

    • Verify protein integrity in biochemical assays (proper folding, post-translational modifications)

    • Consider whether all necessary cofactors or interacting partners are present in vitro

  • Genetic context analysis:

    • Evaluate potential compensatory mechanisms in vivo

    • Consider polar effects on adjacent genes in the atp operon

    • Examine potential secondary mutations that might arise during strain construction

  • Physiological state differences:

    • Compare free-living bacteria versus bacteroid states

    • Consider growth phase-dependent effects

    • Analyze effects of different carbon sources, as R. leguminosarum shows distinct metabolic patterns with different substrates

  • Experimental validation approaches:

    • Correlation analysis between enzyme activity and physiological parameters

    • Time-course experiments to capture dynamic responses

    • Combined transcriptomic/proteomic/metabolomic analysis to get a systems-level view

    • Creating point mutations with graduated effects on activity to establish dose-response relationships

  • Theoretical modeling:

    • Develop mathematical models that integrate biochemical parameters with physiological constraints

    • Use flux balance analysis to predict system-level effects of altered ATP synthase activity

Transcriptomic studies have shown that R. leguminosarum undergoes complex metabolic reprogramming during symbiosis , which may explain differences between simplified in vitro systems and the complex in vivo environment.

How should I analyze transposon sequencing data to identify atpG-related phenotypes?

Analysis of transposon sequencing data to identify atpG-related phenotypes requires sophisticated computational approaches:

  • Essential gene identification:

    • The Tn-HMM python module has been successfully used with R. leguminosarum transposon data to identify essential genes

    • This approach allows classification of genes as essential, growth-advantaged, growth-disadvantaged, or neutral

    • Analysis of R. leguminosarum transposon insertion sequencing data using this method enabled assignment of functional contributions for the majority of genes

  • Comparative analysis across conditions:

    • Cross-referencing datasets from different growth conditions can identify condition-specific requirements

    • In R. leguminosarum, comparison between complex and minimal media identified 72 and 176 genes uniquely required for growth in these respective conditions

    • 516 genes belonged to a "core functional genome" required under both conditions

  • Statistical considerations:

    • Account for insertion biases (transposons have sequence preferences)

    • Normalize for gene length and AT content

    • Apply appropriate statistical tests for differences between conditions

  • Network analysis:

    • Identify genetic interactions by looking for synthetic phenotypes

    • Group genes with similar insertion profiles to identify functional modules

    • Connect with metabolic pathway information for biological context

  • Validation approaches:

    • Confirm key findings with targeted mutations

    • Perform complementation tests to verify gene-phenotype relationships

    • Use alternative functional genomic approaches as independent validation

For atpG specifically, look for effects on genes with related functions or metabolic pathways that might compensate for or be affected by ATP synthase deficiencies.

What statistical methods should be used to analyze ATP synthase activity data?

Appropriate statistical analysis of ATP synthase activity data depends on experimental design and data characteristics:

Table 1: Recommended Statistical Approaches Based on Experimental Design

Experimental DesignAppropriate Statistical MethodsKey Considerations
Comparing two conditions- t-test (parametric)
- Mann-Whitney U (non-parametric)
- Welch's t-test (unequal variances)
- Test for normality (Shapiro-Wilk)
- Check for equal variances (F-test)
- Report effect sizes (Cohen's d)
Multiple conditions- One-way ANOVA + post-hoc tests
- Kruskal-Wallis + Dunn's test
- Nested ANOVA (hierarchical designs)
- Control for multiple comparisons
- Check ANOVA assumptions
- Consider blocking factors
Time-course data- Repeated measures ANOVA
- Mixed-effects models
- Longitudinal data analysis
- Account for autocorrelation
- Handle missing time points
- Consider time as fixed or random effect
Correlation analysis- Pearson correlation (linear)
- Spearman rank (non-parametric)
- Multiple regression
- Check for non-linear relationships
- Identify potential confounders
- Consider multicollinearity

When designing experiments:

  • Include sufficient biological replicates (minimum 3-5 per condition)

  • Consider technical replicates to assess measurement variability

  • Include appropriate positive and negative controls

  • Design experiments to test specific hypotheses about atpG function

For complex study designs involving multiple factors (e.g., strain × growth condition × time), consult with a statistician during the planning phase to ensure appropriate experimental design and analysis approaches.

How can transcriptomic data inform our understanding of atpG regulation?

Transcriptomic data provides valuable insights into atpG regulation within the broader context of cellular metabolism:

  • Expression pattern analysis:

    • Monitor atpG expression across different growth conditions

    • Compare free-living versus symbiotic states

    • Analyze temporal expression during bacteroid development stages (7, 15, and 21 days post-inoculation)

  • Co-expression network identification:

    • Identify genes with expression patterns correlated with atpG

    • Look for co-regulated genes in the ATP synthase operon

    • Discover potential regulatory relationships with other metabolic pathways

  • Condition-specific regulation:

    • Compare expression on different carbon sources (glucose, pyruvate, succinate, inositol, acetate, acetoacetate)

    • Analyze responses to environmental stressors

    • Identify symbiosis-specific regulatory patterns

  • Integration with other data types:

    • Correlate expression with protein abundance (proteomics)

    • Link to metabolite levels (metabolomics)

    • Connect with phenotypic data from mutation studies

  • Upstream regulatory element identification:

    • Analyze promoter regions for potential transcription factor binding sites

    • Look for conserved regulatory elements across Rhizobium species

    • Identify potential small RNA regulation

Transcriptomic analysis of R. leguminosarum has revealed that bacteroid metabolism resembles that of dicarboxylate-grown cells, with specific induction of dicarboxylate transport, gluconeogenesis, and alanine synthesis pathways . These broader metabolic shifts provide context for understanding ATP synthase regulation during symbiosis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.