Recombinant Rhizobium leguminosarum bv. viciae Beta- (1-->2)glucan export ATP-binding/permease protein NdvA (ndvA)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Production

The recombinant NdvA protein is a full-length, 588-amino-acid polypeptide (UniProt ID: P0A2V1) fused with an N-terminal His tag for purification . Key structural and production details include:

PropertySpecification
Expression SystemEscherichia coli (cell-free or in vivo)
Molecular Weight~67.1 kDa (predicted)
DomainsATP-binding domain (NBD), transmembrane domains (TMD)
Purity>85–90% (SDS-PAGE)
StorageLyophilized or liquid in Tris/PBS buffer with 6% trehalose or 50% glycerol

The ATP-binding domain facilitates energy-dependent glucan export, while transmembrane domains form a pore for substrate translocation .

Biological Function

NdvA is part of the ATP-binding cassette (ABC) transporter family and plays a dual role:

  1. Beta-(1→2)glucan Export: Mediates the transport of cyclic beta-(1→2)glucans from the cytoplasm to the periplasm . These glucans are critical for osmoregulation and host infection during symbiosis .

  2. Symbiotic Nodulation: Mutants lacking ndvA fail to form functional root nodules in legumes, resulting in non-nitrogen-fixing "empty" nodules .

Key Functional Insights:

  • Homology to HlyB and Mdr Proteins: NdvA shares structural and functional similarities with E. coli hemolysin exporter HlyB and mammalian multidrug resistance (Mdr) proteins, suggesting conserved ATP-driven transport mechanisms .

  • Defective Mutant Phenotypes: ndvA mutants retain glucan biosynthesis intermediates (e.g., a 235 kDa membrane protein) but lack extracellular glucan, confirming its exclusive role in export .

Table: Experimental Uses of Recombinant NdvA

ApplicationFindingsReferences
Symbiosis StudiesElucidates glucan’s role in rhizobia-legume interactions and biofilm formation
Structural AnalysisUsed in membrane protein crystallization and ATPase activity assays
Host Range InvestigationsComparative studies with Agrobacterium tumefaciens ChvA highlight functional overlap

Key Research Findings

  1. Glucan Export Mechanism:

    • NdvA couples ATP hydrolysis to glucan translocation across the inner membrane .

    • Hydropathy plots reveal conserved transmembrane helices and nucleotide-binding domains across homologs like HlyB and Mdr .

  2. Symbiotic Defects:

    • ndvA mutants exhibit reduced motility and impaired nodulation in Medicago sativa (alfalfa) .

    • Complementation with chvA (a homolog from A. tumefaciens) restores glucan export, confirming functional redundancy .

Biotechnological Relevance

  • Agricultural Engineering: Understanding NdvA’s role aids in optimizing rhizobial inoculants for enhanced nitrogen fixation .

  • Drug Resistance Studies: Insights into ABC transporter mechanics inform strategies to counter multidrug resistance in pathogens .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndvA; RL4640; Beta-(1-->2glucan export ATP-binding/permease protein NdvA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-587
Protein Length
full length protein
Species
Rhizobium leguminosarum bv. viciae (strain 3841)
Target Names
ndvA
Target Protein Sequence
MTLFKVYARALRYLGAYKLRVSLVVVANIVLATITIAEPILFGRIIDAISGKGEVKPILF MWATFAVFNTIAFVLVAREADRLAHGRRATLLTEAFGRIISMPLGWHHQRGTSNALHTLL RACETLFGLWLEFMRNHLSTVIALALLIPTAMSMDLRLSAVLMVLAIAYWLIGRVVMSRT KDGQASVENHYHTVFSHVSDSISNVSVLHSYNRIEAETRALKSFADRLLEAQYPVLDWWA IASALNRMASTIAMMVVLIIGTMLVQAGQLRVGDVIAFIGFANLLIGRLDLMRQFATQIF EARSKLEEFYALEDSVREREEPAGNGEIKDVKGAIEFRDVSFGFGNSSQGLHNVSFSVKA GQTVAIVGPTGAGKTTLVNLLQRVYDAQGGKILVDGTDITKVTRKSLRRHIATVFQDAGL LNRSISDNIRLGREGASEEEMRRAAEAAAAADFIETREDRYDTHVGERGNKLSGGERQRI AIARAILKDAPILVLDEATSALDVETEARVKAAIDNLRQNRTTFIIAHRLSTVREADMVL FLDDGRVVEQGSFDELSHSNGRFAALLRASGILTDEEVRKAHTTEAA
Uniprot No.

Target Background

Function
This protein plays a role in beta-(1-->2)glucan export. Transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: rle:RL4640

STRING: 216596.RL4640

Protein Families
ABC transporter superfamily, Beta-(1-->2)glucan exporter (TC 3.A.1.108.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of NdvA in Rhizobium leguminosarum?

NdvA functions as an ATP-binding/permease protein responsible for exporting beta-(1-->2)glucans across bacterial membranes. It catalyzes the reaction: ATP + H₂O + beta-glucan(Side 1) = ADP + phosphate + beta-glucan(Side 2) . This transport process is crucial for establishing effective symbiotic relationships with leguminous host plants. The protein belongs to the ABC transporter family, which uses energy from ATP hydrolysis to transport various substrates across membranes. NdvA specifically contains ABC transporter-like ATP-binding domains, P-loop containing nucleoside triphosphate hydrolase domains, and transmembrane domains typical of type 1 transporters .

How does NdvA structure relate to its function?

NdvA forms a homodimeric complex that facilitates beta-glucan export . The protein contains 599 amino acids with a theoretical weight of 66.03 KDa, as determined from structural studies . Each monomer consists of multiple domains including:

  • ATP-binding domains containing the characteristic P-loop

  • Transmembrane domains that form the channel for glucan export

  • Conserved sequence motifs typical of ABC transporters

The quaternary structure of NdvA enables conformational changes during the transport cycle, where ATP binding and hydrolysis drive the movement of beta-glucans across the membrane. The crystallographic structure of NdvA (PDB: 7zoa) has revealed how these conformational changes facilitate the transport mechanism .

How is ndvA expression regulated in Rhizobium leguminosarum?

The ndvA gene expression in Rhizobium leguminosarum is regulated as part of the symbiotic gene network. While the specific regulation of ndvA hasn't been extensively characterized in the search results, regulation patterns likely follow those of other symbiotic genes in Rhizobium. Experimental approaches to study ndvA expression typically include:

  • Quantitative PCR to measure transcript levels under different conditions

  • Promoter-reporter fusions to visualize expression patterns

  • Transcriptomic analyses to identify co-regulated genes

Similar to nodulation (nod) genes that are highly polymorphic and contribute to host specificity, ndvA expression may be regulated in response to plant signals and environmental conditions .

What experimental approaches can determine the substrate specificity of NdvA?

To determine the substrate specificity of NdvA, researchers should employ a multi-faceted approach:

  • In vitro transport assays: Using purified NdvA reconstituted in liposomes to measure transport rates of different beta-glucan substrates.

  • Site-directed mutagenesis: Identifying key residues in the substrate-binding pocket by creating point mutations and assessing their impact on transport efficiency.

  • Structural analysis: Using X-ray crystallography or cryo-EM to resolve structures of NdvA bound to different substrates.

  • Competition assays: Measuring the transport of a labeled beta-glucan in the presence of potential competing substrates.

  • Isothermal titration calorimetry (ITC): Quantifying the binding affinity of NdvA for different substrates.

The substrate specificity can be presented in a comparative table:

Beta-glucan variantTransport efficiencyBinding affinity (Kd)ATP hydrolysis rate
Linear β-(1→2)++xx μMxx nmol/min/mg
Cyclic β-(1→2)++++xx μMxx nmol/min/mg
Mixed linkage+xx μMxx nmol/min/mg
Other polysaccharides-xx μMxx nmol/min/mg

How can I optimize expression and purification of recombinant NdvA?

Optimizing recombinant NdvA expression and purification requires careful consideration of expression systems and purification strategies:

Expression optimization:

  • Expression system selection: Use E. coli strains specifically designed for membrane protein expression (C41, C43, or Lemo21) .

  • Induction conditions: Optimize temperature (typically 16-25°C), inducer concentration, and induction time.

  • Fusion tags: Test multiple fusion tags (His6, MBP, SUMO) to enhance solubility and facilitate purification.

  • Co-expression strategies: Co-express with chaperones to improve folding and stability.

Purification protocol:

  • Membrane extraction: Use detergents like DDM, LMNG, or GDN that maintain protein stability and activity.

  • Affinity chromatography: Utilize nickel or cobalt resin for His-tagged constructs.

  • Size exclusion chromatography: Separate dimeric NdvA from aggregates and other contaminants.

  • Stability assessment: Test protein stability in different buffer conditions using thermal shift assays.

Activity of purified NdvA should be verified through ATPase assays and functional reconstitution into proteoliposomes to confirm beta-glucan transport capability.

What approaches can reveal the mechanism of NdvA's ATP hydrolysis cycle?

Understanding NdvA's ATP hydrolysis cycle requires detailed mechanistic studies:

  • Pre-steady state kinetics: Use rapid mixing techniques (stopped-flow, quenched-flow) to identify intermediate states during ATP hydrolysis.

  • ATP analogs: Employ non-hydrolyzable ATP analogs (AMP-PNP, ATP-γ-S) to trap NdvA in specific conformational states.

  • Mutational analysis: Create mutations in the Walker A and B motifs, signature motif, and other conserved regions to identify residues critical for ATP binding and hydrolysis.

  • Conformational dynamics: Use hydrogen-deuterium exchange mass spectrometry or FRET to monitor conformational changes during the transport cycle.

  • Molecular dynamics simulations: Conduct simulations to visualize the coupling between ATP hydrolysis and substrate translocation.

A proposed ATP hydrolysis mechanism would include:

  • ATP binding to nucleotide-binding domains

  • Dimerization of ATP-binding domains

  • Conformational changes in transmembrane domains

  • ATP hydrolysis

  • ADP and phosphate release

  • Return to resting state

This cycle drives the alternating access model that facilitates beta-glucan transport across the membrane.

What are the key considerations when designing experiments to investigate NdvA mutants?

When designing experiments to investigate NdvA mutants, researchers should consider:

  • Mutation strategy:

    • Target specific functional domains (ATP-binding, substrate-binding, transmembrane regions)

    • Create both alanine scanning mutations and more conservative substitutions

    • Consider evolutionarily conserved residues identified through multiple sequence alignments

  • Functional complementation:

    • Test whether mutant NdvA can rescue ndvA-deficient strains

    • Assess beta-glucan export in vivo using appropriate bioassays

    • Quantify symbiotic efficiency with host plants

  • Biochemical characterization:

    • Measure ATP binding and hydrolysis rates of purified mutant proteins

    • Assess oligomerization status using analytical ultracentrifugation or native PAGE

    • Determine stability and folding using circular dichroism spectroscopy

  • Structural impact:

    • Perform limited proteolysis to assess conformational changes

    • Use structure-guided mutagenesis to test hypotheses about transport mechanism

    • When possible, determine structures of key mutants

  • Controls:

    • Include wild-type NdvA as positive control

    • Use catalytically inactive mutant (e.g., Walker A lysine mutation) as negative control

    • Verify expression levels of all mutants being compared

Similar approaches have been effectively employed in studies of nodulation proteins, where complementation experiments with specific genes like nodX have revealed important mechanisms of host specificity .

What methods are most effective for studying NdvA-mediated beta-glucan export in vivo?

Studying NdvA-mediated beta-glucan export in vivo requires specialized techniques:

  • Genetic approaches:

    • Create ndvA knockout strains using CRISPR-Cas9 or homologous recombination

    • Complement with wild-type or mutant ndvA under native or inducible promoters

    • Use fluorescent protein fusions to track NdvA localization

  • Beta-glucan quantification:

    • Extract and purify beta-glucans from cell and culture supernatant

    • Quantify using colorimetric assays (anthrone method)

    • Analyze structure using NMR spectroscopy or mass spectrometry

    • Use labeled precursors to track newly synthesized glucans

  • Symbiotic phenotype assessment:

    • Measure nodule formation efficiency with host plants

    • Quantify nitrogen fixation rates using acetylene reduction assay

    • Assess competitive ability in mixed inoculation experiments similar to those used in studying Rhizobium leguminosarum host-specific competitiveness

  • Microscopy techniques:

    • Use electron microscopy to visualize infection thread formation

    • Employ confocal microscopy with fluorescently labeled beta-glucans

    • Track NdvA-GFP localization during symbiotic stages

When designing these experiments, it's important to include appropriate controls and to assess beta-glucan export under different environmental conditions that might affect symbiotic relationships.

How can I design a robust assay to measure NdvA ATPase activity?

A robust assay for measuring NdvA ATPase activity should include the following components:

  • Protein preparation:

    • Use highly purified NdvA (>95% purity)

    • Ensure protein is properly folded and in active conformation

    • Stabilize in appropriate detergent or nanodisc environment

  • Reaction conditions optimization:

    • Test range of pH values (typically 6.5-8.0)

    • Optimize buffer composition (HEPES, Tris, phosphate)

    • Determine optimal temperature (usually 25-37°C)

    • Titrate divalent cations (Mg²⁺, Mn²⁺)

  • Activity measurement methods:

    • Colorimetric phosphate detection (malachite green assay)

    • Coupled enzyme assay (pyruvate kinase/lactate dehydrogenase)

    • Direct measurement using [γ-³²P]ATP

    • Real-time monitoring using stopped-flow techniques

  • Data analysis:

    • Determine kinetic parameters (Km, Vmax, kcat)

    • Assess substrate specificity by varying ATP analogs

    • Test effect of potential inhibitors

    • Analyze cooperativity using Hill plots

  • Controls:

    • Include no-enzyme controls

    • Use known ABC transporter inhibitors as negative controls

    • Test catalytically inactive mutant (Walker A lysine mutation)

    • Include positive control (another well-characterized ABC transporter)

Results from ATPase assays can be presented as follows:

ParameterValueConditions
Km (ATP)xx μMpH 7.5, 30°C
Vmaxxx nmol Pi/min/mgpH 7.5, 30°C
kcatxx s⁻¹pH 7.5, 30°C
Hill coefficientxxpH 7.5, 30°C
Optimal pHxx30°C
Optimal temperaturexx°CpH 7.5
Mg²⁺ requirementxx mMpH 7.5, 30°C

How should I interpret contradictory results from different NdvA functional assays?

When faced with contradictory results from different NdvA functional assays, follow this systematic approach:

  • Technical validation:

    • Verify assay reproducibility with biological and technical replicates

    • Confirm protein quality and activity using standard controls

    • Rule out experimental artifacts through independent methodologies

    • Validate antibodies and reagents used in experiments

  • Contextual analysis:

    • Consider differences in experimental conditions (pH, temperature, ionic strength)

    • Assess the impact of detergents or lipid environment on protein activity

    • Examine differences in protein constructs (tags, truncations, mutations)

    • Evaluate cellular context (heterologous expression vs. native environment)

  • Integrative approach:

    • Prioritize results from multiple convergent methodologies

    • Consider the physiological relevance of each assay system

    • Develop working models that accommodate seemingly contradictory data

    • Design critical experiments to distinguish between competing hypotheses

  • Statistical analysis:

    • Apply appropriate statistical tests to determine significance of differences

    • Consider power analysis to ensure adequate sample sizes

    • Use Bayesian approaches to integrate data from multiple sources

This approach is similar to how researchers have addressed complex data regarding host-specific nodulation, where multiple genetic determinants beyond single genes like nodX have been found to influence symbiotic interactions .

What statistical approaches are recommended for analyzing NdvA structure-function relationship data?

For analyzing NdvA structure-function relationship data, employ these statistical approaches:

  • Correlation analyses:

    • Use Pearson or Spearman correlation to relate structural parameters to functional outcomes

    • Apply principal component analysis (PCA) to identify key structural determinants of function

    • Implement multiple regression models to quantify contributions of different structural elements

  • Comparative analyses:

    • Employ ANOVA or Kruskal-Wallis tests to compare multiple structural variants

    • Use post-hoc tests (Tukey's, Bonferroni) for pairwise comparisons

    • Implement hierarchical clustering to group functionally similar mutants

  • Advanced modeling:

    • Develop structure-based predictive models using machine learning approaches

    • Apply Molecular Dynamics simulation analysis techniques

    • Use Markov State Models to connect structural dynamics to function

  • Validation strategies:

    • Implement cross-validation to assess model robustness

    • Use bootstrapping to generate confidence intervals

    • Apply Bayesian analysis to incorporate prior knowledge

  • Visualization techniques:

    • Heat maps for correlation matrices

    • 3D structural mapping of functional data

    • Network analysis to visualize interactions between structural elements

These statistical approaches can help identify critical residues for NdvA function, similar to how researchers have identified polymorphic regions in nodulation genes that contribute to host specificity .

How can I validate NdvA's role in symbiotic relationships using multiple approaches?

Validating NdvA's role in symbiotic relationships requires a multi-faceted approach:

  • Genetic validation:

    • Create precise ndvA knockout mutants using CRISPR-Cas9 or allelic exchange

    • Complement with wild-type ndvA to confirm phenotype restoration

    • Implement conditional expression systems to study temporal requirements

    • Create point mutations in key functional domains for structure-function analysis

  • Biochemical validation:

    • Quantify beta-glucan levels in wild-type vs. ndvA mutant strains

    • Analyze structural differences in exported beta-glucans

    • Measure changes in ATPase activity with different beta-glucan substrates

    • Purify and reconstitute NdvA to demonstrate direct transport activity

  • Symbiotic phenotype characterization:

    • Conduct plant inoculation assays to assess nodulation efficiency

    • Quantify nitrogen fixation using acetylene reduction assays

    • Perform competitive nodulation assays with mixed inoculation

    • Use microscopy to examine infection thread formation and nodule development

  • Systems biology approaches:

    • Conduct transcriptomic analysis to identify genes co-regulated with ndvA

    • Use metabolomics to assess changes in symbiotic signaling molecules

    • Employ proteomics to identify NdvA interaction partners

    • Develop mathematical models of beta-glucan export during symbiosis

  • Comparative analysis across species:

    • Assess conservation of NdvA function in different Rhizobium species

    • Compare beta-glucan export mechanisms across different bacterial symbionts

    • Test host range specificity similar to experiments with nodulation genes

This comprehensive validation strategy will provide robust evidence for NdvA's specific role in symbiotic relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.