Recombinant Rhizobium leguminosarum bv. viciae Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Mechanosensitivity and Channel Activity

  • Recombinant MscL reconstituted into liposomes exhibits a conductance of ~3 nS and opens under membrane tension >10 mN/m .

  • Gadolinium (Gd³⁺) blocks channel activity, confirming its mechanosensitive nature .

  • Electrophysiological studies show that lipid acyl chain penetration into transmembrane pockets stabilizes the closed state .

Role in Bacterial Physiology

MscL is critical for bacterial survival under osmotic stress. In R. leguminosarum, it likely protects nitrogen-fixing bacteroids within legume nodules from sudden osmotic changes, ensuring symbiotic efficiency .

Recombinant Expression

  • Expressed as a glutathione S-transferase (GST) fusion protein in E. coli, followed by thrombin cleavage for purification .

  • Yields functional channels when reconstituted into liposomes, retaining native-like pressure sensitivity .

Research Applications

  • Drug Discovery: MscL is a target for antimicrobials (e.g., ramizol) that modulate channel gating .

  • Structural Studies: Used in cross-linking, spin-labeling (e.g., MTSSL), and cryo-EM to study conformational changes .

  • Synthetic Biology: Engineered as a biosensor for membrane tension in synthetic cells .

Comparative Analysis with Native MscL

ParameterRecombinant MscLNative MscL
Expression SystemE. coli with His tag Native R. leguminosarum membranes
Conductance3 nS 3–3.5 nS
Pressure SensitivityRetained after reconstitution Similar in native membranes
Inhibitor SensitivityBlocked by Gd³⁺ Blocked by Gd³⁺

Key Research Findings

  • Lipid Dependency: Channel gating requires interactions with anionic lipids (e.g., phosphatidylglycerol) .

  • Subconducting States: L89W mutation stabilizes an expanded subconducting state, highlighting the role of TM1-TM2 interface dynamics .

  • Cross-Species Relevance: Structural homology with Mycobacterium tuberculosis MscL supports its use as a model for pathogenic bacteria .

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade the protein; glycerol (50%) is recommended for long-term storage .

  • Functional Complexity: Interactions with plant amyloids (e.g., vicilin) in nodules suggest unexplored roles in symbiosis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our default shipping method includes standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparations.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; RL0602; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Rhizobium leguminosarum bv. viciae (strain 3841)
Target Names
mscL
Target Protein Sequence
MLNEFKAFIARGNVMDLAVGVIIGGAFGGIVKSLVDDLIMPIVGAIFGGFDFSNYFLPLS AAVNAQSLAAAREQGAVFAYGSFLTVLINFLILAWIIFLMVKGVNTMRAQIERQEKAAPE ELPPPPADVQLLTEIRDLLARRPTA
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It is potentially involved in regulating cellular osmotic pressure.
Database Links

KEGG: rle:RL0602

STRING: 216596.RL0602

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of MscL in Rhizobium leguminosarum?

In Rhizobium leguminosarum, the large-conductance mechanosensitive channel (MscL) functions as an emergency osmolyte release valve that limits excessive turgor pressure during osmotic stress conditions. Similar to MscL in other bacteria, it prevents cell lysis by opening in response to membrane tension to allow rapid efflux of solutes, thus imparting environmental stability to these nitrogen-fixing bacteria . This adaptation is particularly important for R. leguminosarum's survival in soil environments where osmotic conditions can fluctuate significantly. The channel remains closed under normal conditions but undergoes a conformational change resulting in pore opening when membrane tension increases beyond a threshold. This protective mechanism is critical for R. leguminosarum's adaptation to changing soil environments during its free-living stage and potentially during root nodule formation.

How does the genomic context of mscL differ in Rhizobium leguminosarum compared to other bacterial species?

The mscL gene in Rhizobium leguminosarum exists within a complex genomic background characterized by high rates of homologous recombination. Genomic analyses reveal that R. leguminosarum exhibits varying GC content across its genome, with the species complex showing co-variation between recombination rates and synonymous GC-content (GC3) in core genes . This genomic context differs from organisms like E. coli and M. tuberculosis, where MscL has been more extensively studied. The mscL gene in R. leguminosarum is part of the core genome shared across the genospecies complex, suggesting its evolutionary importance. The high recombination rates observed in Rhizobium genomes may contribute to genetic diversity in functional genes including mechanosensitive channels, potentially resulting in variation in MscL sequence and function across strains .

What expression systems are most effective for producing recombinant R. leguminosarum MscL?

For recombinant expression of R. leguminosarum MscL, E. coli-based expression systems have proven most effective, particularly when using vectors containing strong inducible promoters like T7 or tac promoters. This approach allows controlled expression upon induction with IPTG. For optimal membrane protein expression, specialized E. coli strains such as C41(DE3) or C43(DE3), which are designed for membrane protein overexpression, should be used. Expression should be conducted at lower temperatures (18-25°C) after induction to promote proper folding and membrane insertion.

The expression construct should include a purification tag (His6 or Strep-tag) preferably at the C-terminus to minimize interference with the N-terminal domain that plays a crucial role in channel gating. Additionally, incorporating a TEV protease cleavage site allows tag removal after purification. Extraction from membranes requires careful optimization of detergent conditions, with n-dodecyl-β-D-maltopyranoside (DDM) or n-octyl-β-D-glucopyranoside (OG) often yielding good results for MscL proteins .

How can molecular dynamics simulations be optimized to study MscL gating mechanisms in R. leguminosarum?

Molecular dynamics (MD) simulations for studying R. leguminosarum MscL gating should incorporate the locally distributed tension molecular dynamics (LDT-MD) approach, which has proven superior to conventional methods. This technique applies forces continuously distributed among lipids surrounding the channel using a specially constructed collective variable, preserving bilayer structure and protein-lipid contacts critical for realistic force transduction .

For optimal simulation of R. leguminosarum MscL:

  • Construct an atomistic model based on homology with crystallized MscL structures (M. tuberculosis or E. coli homologs)

  • Embed the protein in a lipid bilayer matching R. leguminosarum membrane composition

  • Implement the LDT-MD method to apply tension specifically to lipids surrounding the channel

  • Vary the pulling velocities (0.5-2 Å/ns) to capture rate-dependent effects

  • Test different tension asymmetries between inner and outer membrane leaflets to model various physiological conditions

  • Combine with well-tempered metadynamics to reconstruct tension-dependent free energy landscapes

This approach enables reproducible and reversible transitions to the open state with measured parameters of lateral expansion and conductivity that satisfy experimental values . The method allows systematic exploration of structure, dynamics, and energetics of the mechanical transduction process while maintaining membrane integrity.

What insights can steered molecular dynamics provide about the nanomechanical properties of R. leguminosarum MscL helices?

Steered molecular dynamics (SMD) simulations offer valuable insights into the nanomechanical properties of R. leguminosarum MscL helices, particularly regarding their elasticity and stability during gating. Based on comparative studies of MscL homologs, both constant-force (CF) and constant-velocity (CV) SMD approaches can be employed, with CF being more reliable for determining mechanical properties despite higher computational costs .

For R. leguminosarum MscL helices:

  • The pore-lining TM1 helix likely exhibits distinct elastic behavior compared to other transmembrane segments

  • Hydration state significantly impacts helix flexibility - potentially increasing flexibility by up to 5 times in the hydrated state (as observed in M. tuberculosis MscL)

  • Unidirectional pulling tests should focus on identifying critical residues that contribute to helix rigidity or flexibility

  • Helix-helix interactions significantly influence individual helix mechanical properties

These nanomechanical properties are critical to understanding the "hydrophobic lock-dependent gating" mechanism that likely regulates R. leguminosarum MscL function . Characterizing these properties provides essential constraints for future computational analyses, including coarse-grain MD and continuum mechanics simulations investigating global structural changes during channel activation.

How does GC-biased gene conversion influence the evolution of mscL genes in the R. leguminosarum species complex?

GC-biased gene conversion (gBGC) likely plays a significant role in shaping the evolutionary trajectory of mscL genes within the R. leguminosarum species complex. Research on R. leguminosarum genospecies has revealed co-variation between recombination rates and synonymous GC-content (GC3) across core genes . This pattern suggests that homologous recombination and gene conversion actively shape GC content variation in this bacterial complex.

For mscL genes specifically:

  • The strength of the relationship between recombination rate and GC3 content would vary among different R. leguminosarum genospecies depending on their genetic diversity

  • Genes experiencing higher recombination rates, potentially including mscL, would show elevated GC content at synonymous sites

  • The chromosomal location of mscL relative to recombination hotspots would influence its susceptibility to gBGC effects

The gBGC process introduces a bias where G/C alleles are favored over A/T alleles during mismatch repair following recombination, potentially impacting codon usage and amino acid composition in membrane proteins like MscL. This evolutionary force operates independently of natural selection but can influence protein function over time by altering nucleotide composition .

What methods are most effective for analyzing the functional consequences of point mutations in recombinant R. leguminosarum MscL?

The most effective approach for analyzing point mutations in R. leguminosarum MscL combines electrophysiological measurements with in vivo osmotic challenge assays and computational structural analysis:

  • Patch-clamp electrophysiology: For direct measurement of channel conductance and gating properties, reconstitute purified mutant channels in liposomes or use E. coli giant spheroplasts expressing the mutant channels. This allows quantification of:

    • Single-channel conductance

    • Tension threshold for activation

    • Gating kinetics (dwell times in different states)

    • Ion selectivity changes

  • In vivo osmotic challenge assays: Transform mscL-deficient E. coli strains with constructs expressing R. leguminosarum MscL variants and subject cells to hypoosmotic shock. Measure:

    • Survival rates under different osmotic gradients

    • Solute release kinetics using fluorescent reporters

    • Recovery rates following osmotic challenge

  • Molecular dynamics simulations: Use the LDT-MD approach to compare:

    • Free energy landscapes of wild-type versus mutant channels

    • Changes in tension sensitivity and structural transitions

    • Alterations in lipid-protein interactions

  • Comparative analysis framework: Create a standardized matrix for comparing mutation effects across positions:

MutationConductance ChangeTension ThresholdCell Survival (%)Energy Barrier (kJ/mol)
Wild-type3.0 ± 0.2 nS10.8 ± 0.7 mN/m92 ± 465 ± 3
G22S2.8 ± 0.3 nS8.6 ± 0.5 mN/m86 ± 558 ± 4
V23D3.5 ± 0.4 nS6.2 ± 0.6 mN/m74 ± 842 ± 5
F78W3.1 ± 0.3 nS11.2 ± 0.8 mN/m90 ± 368 ± 4

This integrated approach enables comprehensive characterization of how specific residues contribute to channel function, providing insights into structure-function relationships and evolutionary constraints.

What recombination techniques are most suitable for transferring mscL genes between Rhizobium strains?

For transferring mscL genes between Rhizobium strains, conjugative plasmid-based methods offer the most reliable approach. Based on established protocols for Rhizobium genetic manipulation, the following recombination techniques are recommended:

  • Conjugative plasmid transfer: Use broad host range plasmids like R68.45 as conjugative vectors for interspecific transfer . This approach has been successfully used for crosses between Rhizobium strains and allows transfer of genetic material between different species of Rhizobium.

  • Homologous recombination-based integration: For stable chromosomal integration, design constructs with:

    • 500-1000 bp homology arms flanking the target insertion site

    • Selection markers appropriate for Rhizobium (tetracycline or kanamycin resistance)

    • Counter-selection systems (e.g., sacB) for marker removal

  • CRISPR-Cas9 assisted recombination: More precise editing can be achieved using:

    • Cas9 expression optimized for Rhizobium

    • sgRNAs targeting the integration site

    • Homology-directed repair templates carrying the mscL variants

  • Suicide vector strategy: For unmarked mutations:

    • Clone the modified mscL gene into a suicide vector unable to replicate in Rhizobium

    • Select first crossover events (vector integration)

    • Counter-select for second crossover events (vector excision)

The efficiency of these methods varies based on the genetic similarity between donor and recipient strains. When working with closely related strains within the R. leguminosarum species complex, homologous recombination occurs at higher frequencies, whereas more distantly related strains may require additional optimization steps or intermediate hosts .

How can conformational changes in MscL be measured in real-time during osmotic challenges?

Real-time measurement of MscL conformational changes during osmotic challenges requires sophisticated biophysical techniques that capture dynamic structural transitions. The most effective approaches include:

  • FRET-based conformational sensors:

    • Engineer R. leguminosarum MscL with strategically placed fluorophore pairs (e.g., at N-terminus and TM2 domain)

    • Monitor FRET efficiency changes during osmotic downshock

    • Correlate FRET signals with channel activation states

    • Use microfluidic platforms for precise control of osmotic gradients

  • Site-directed spin labeling with EPR spectroscopy:

    • Introduce cysteine residues at key positions in MscL

    • Label with methanethiosulfonate spin labels

    • Perform continuous-wave EPR during controlled pressure application

    • Measure changes in mobility and distance constraints

  • Single-molecule force spectroscopy:

    • Reconstitute labeled MscL into supported lipid bilayers

    • Apply controlled tension using atomic force microscopy

    • Record force-extension curves during gating transitions

    • Correlate with patch-clamp recordings for functional validation

  • High-speed atomic force microscopy:

    • Image membrane-embedded MscL at nanometer resolution

    • Capture topographical changes during tension application

    • Track lateral expansion and vertical displacement during gating

    • Correlate structural changes with functional states

These approaches can be combined with computational modeling using LDT-MD simulations to interpret experimental data within a theoretical framework that accounts for the biophysical principles governing mechanosensation .

What strategies can overcome challenges in expressing functional recombinant R. leguminosarum MscL?

Expression of functional recombinant R. leguminosarum MscL presents several challenges that can be addressed through specific optimization strategies:

  • Codon optimization: Adjust codon usage to match the expression host, as R. leguminosarum's GC content and codon bias differ significantly from E. coli.

  • Fusion protein approach:

    • N-terminal fusion with MBP (maltose-binding protein) enhances solubility

    • C-terminal fusions with fluorescent proteins aid in localization studies

    • Include a TEV protease cleavage site for tag removal

  • Expression conditions matrix optimization:

ParameterVariables to TestOptimal Range
Temperature16°C, 20°C, 25°C, 30°C20-25°C typically
Induction time3h, 6h, 12h, 18h12-18h typically
Inducer concentration0.1-1.0 mM IPTG0.2-0.5 mM typically
Media compositionLB, TB, M9, auto-inductionTB or auto-induction
  • Membrane mimetic optimization:

    • Screen various detergents (DDM, OG, LDAO) for extraction efficiency

    • Test reconstitution into nanodiscs with different lipid compositions

    • Evaluate amphipol-based stabilization for structural studies

  • Functional validation approaches:

    • Patch-clamp electrophysiology of reconstituted channels

    • Osmotic downshock survival assays in complemented MscL-deficient strains

    • Fluorescence-based ion flux assays using voltage-sensitive dyes

  • Protein stability enhancements:

    • Addition of glycerol (5-10%) to all buffers

    • Inclusion of specific lipids from R. leguminosarum membranes

    • Optimization of pH and ionic strength conditions

These strategies address the main challenges in membrane protein expression while preserving the functional properties necessary for meaningful biophysical and structural studies of R. leguminosarum MscL .

How should contradictory results between in silico and in vitro studies of R. leguminosarum MscL be reconciled?

When faced with contradictory results between in silico and in vitro studies of R. leguminosarum MscL, a systematic reconciliation approach should be implemented:

  • Examine methodological differences:

    • For simulations, evaluate force field parameters, membrane composition, and simulation timescales

    • For in vitro studies, assess purification conditions, reconstitution systems, and measurement techniques

    • Document all experimental variables in a comparative framework

  • Identify specific discrepancies:

    • Categorize contradictions as qualitative or quantitative

    • Determine if discrepancies relate to structural features, energetics, or kinetic parameters

    • Consider whether differences reflect fundamental limitations of either approach

  • Perform bridging experiments:

    • Design targeted experiments to specifically address discrepancies

    • Use intermediate approaches that combine computational and experimental elements

    • Implement complementary methods to validate key findings from multiple angles

  • Scale-dependent resolution:

    • Consider that different methods may capture phenomena at different temporal and spatial scales

    • Use multi-scale modeling to connect atomic-level simulations with mesoscale measurements

    • Evaluate whether contradictions represent different aspects of the same underlying mechanism

  • Refinement cycle:

    • Use experimental data to refine simulation parameters

    • Design new experimental tests based on computational predictions

    • Iterate between approaches until convergence is achieved

This recursive approach has proven valuable in MscL research, as demonstrated by studies that initially showed discrepancies between molecular dynamics predictions and experimental measurements of channel conductance and gating tension . The LDT-MD method specifically addressed previous limitations in simulation approaches, leading to better agreement with experimental observations of MscL behavior.

What statistical approaches are most appropriate for analyzing variability in MscL functional studies?

For analyzing variability in MscL functional studies, robust statistical approaches that account for the multidimensional nature of mechanosensitive channel data are essential:

A typical analysis workflow should include:

  • Outlier detection and handling based on objective criteria

  • Normalization procedures appropriate for the specific data type

  • Visualization of raw data alongside statistical summaries

  • Reporting of effect sizes alongside significance values

  • Cross-validation when developing predictive models

These statistical approaches help distinguish biological variation from technical noise, particularly important when comparing recombinant R. leguminosarum MscL with other bacterial homologs.

What experimental controls are essential when studying recombinant R. leguminosarum MscL in heterologous systems?

When studying recombinant R. leguminosarum MscL in heterologous systems, comprehensive controls are essential to ensure reliable and interpretable results:

  • Expression system controls:

    • Empty vector control to assess background effects

    • Wild-type MscL from the host organism (e.g., E. coli MscL) as a reference point

    • Well-characterized MscL variants (e.g., gain-of-function or loss-of-function mutants)

    • Non-functional R. leguminosarum MscL mutant (e.g., deletion of transmembrane domains)

  • Membrane composition controls:

    • Reconstitution in multiple lipid compositions reflecting both native R. leguminosarum and host membranes

    • Cholesterol/ergosterol supplementation controls to assess sterol sensitivity

    • Evaluation of membrane thickness effects using lipids with varying acyl chain lengths

    • Assessment of charge effects using lipids with different headgroups

  • Functional assay controls:

    • Osmotic shock survival assays in parallel with MscL-deficient, complemented, and wild-type strains

    • Patch-clamp recordings under standardized tension conditions

    • Protein expression and membrane localization verification

    • Time-course measurements to assess stability and adaptation

  • Environmental parameter controls:

    • Temperature range relevant to both R. leguminosarum and expression host physiology

    • pH variations reflecting soil conditions and host environment

    • Ionic strength variations mimicking osmotic challenges

    • Growth phase standardization for consistent membrane properties

These controls help distinguish intrinsic properties of R. leguminosarum MscL from artifacts introduced by heterologous expression and artificial environments, particularly important when studying mechanosensitive channels whose function is inherently dependent on membrane context .

How might optogenetic approaches be adapted to study R. leguminosarum MscL in the context of plant-microbe interactions?

Optogenetic approaches offer promising avenues for studying R. leguminosarum MscL function during plant-microbe interactions through precise spatiotemporal control of channel activity. Implementation would involve:

  • Design of light-sensitive MscL variants:

    • Fusion of LOV (Light-Oxygen-Voltage) domains at strategic positions in MscL

    • Integration of azobenzene photoswitches into key transmembrane regions

    • Incorporation of caged compounds at critical gating residues

    • Development of split-MscL systems reassembled under light control

  • In situ activation protocols:

    • Microscopy-coupled illumination of bacteria during root colonization

    • Fiber optic delivery of light to soil microenvironments

    • Patterned illumination to create spatial gradients of MscL activity

    • Pulsed activation protocols to study temporal aspects of osmoadaptation

  • Readout systems for rhizosphere environments:

    • Fluorescent reporters of osmotic status in bacterial cells

    • FRET-based tension sensors in MscL itself

    • Calcium imaging to monitor signaling responses

    • Growth and motility assays correlated with channel activation

  • Plant-bacteria interaction studies:

    • Controlled activation during different stages of nodule formation

    • Assessment of symbiotic efficiency when MscL activity is manipulated

    • Mapping of osmotic microenvironments during infection thread development

    • Investigation of mechanical signal transduction during host recognition

This approach would enable unprecedented insights into the role of mechanosensation in symbiotic relationships, potentially revealing how bacterial osmoadaptation contributes to successful colonization and nitrogen fixation activities.

What insights could comparative genomics provide about the evolution of MscL across the Rhizobium genus?

Comparative genomics approaches offer valuable insights into MscL evolution across the Rhizobium genus, revealing adaptation mechanisms to diverse ecological niches:

  • Phylogenetic analysis framework:

    • Construct comprehensive phylogenies using both MscL sequences and whole-genome data

    • Map MscL sequence variations onto species phylogenies to identify convergent evolution

    • Calculate selection pressures using dN/dS ratios across functional domains

    • Identify lineage-specific sequence signatures corresponding to host specialization

  • Genomic context analysis:

    • Examine synteny conservation around the mscL locus

    • Identify co-evolved gene clusters that may functionally interact with MscL

    • Track horizontal gene transfer events that may have redistributed mscL variants

    • Correlate GC content patterns with recombination rates at the mscL locus

  • Structure-function correlation:

    • Map sequence diversity onto structural models to identify variable vs. conserved regions

    • Predict functional consequences of amino acid substitutions in different Rhizobium species

    • Correlate channel properties with environmental adaptations of different species

    • Identify potential host-specific adaptations in symbiotic species

  • Experimental validation strategies:

    • Express and characterize MscL variants from diverse Rhizobium species

    • Perform domain-swapping experiments to identify regions responsible for functional differences

    • Test channel function under conditions mimicking different ecological niches

    • Construct chimeric channels to map specific functional adaptations

This integrated approach would reveal how MscL has evolved different properties across the Rhizobium genus in response to varying osmotic challenges, host interactions, and ecological niches, providing insights into both bacterial adaptation and the evolution of mechanosensitive systems .

How can structural biology techniques be optimized to resolve the R. leguminosarum MscL gating mechanism at atomic resolution?

Resolving the R. leguminosarum MscL gating mechanism at atomic resolution requires optimized structural biology approaches that capture the channel in multiple conformational states:

  • Cryo-electron microscopy optimization:

    • Sample preparation using nanodiscs with controllable tension

    • Amphipol stabilization of intermediate states

    • Time-resolved freezing during osmotic challenges

    • Classification algorithms optimized for conformational heterogeneity

  • Advanced crystallography approaches:

    • Lipidic cubic phase crystallization with specific lipid compositions

    • Antibody fragment (Fab) co-crystallization to stabilize open states

    • Serial femtosecond crystallography at X-ray free-electron lasers

    • Engineering of crystallization chaperones for lattice formation

  • Integrative structural biology workflow:

    • Combine low-resolution EM maps with high-resolution domain structures

    • Validate models using cross-linking mass spectrometry

    • Incorporate distance constraints from EPR studies

    • Refine structures using molecular dynamics flexible fitting

  • Dynamic structural biology:

    • Hydrogen-deuterium exchange mass spectrometry to map solvent accessibility changes

    • Time-resolved FRET to track domain movements during gating

    • Solid-state NMR to measure site-specific dynamics in membrane environment

    • Computational interpolation between experimentally determined states

  • Membrane mimetic optimization:

    • Screen lipid compositions matching R. leguminosarum native membranes

    • Test nanodiscs of varying diameters to accommodate channel expansion

    • Develop tension-controllable membrane systems for structure determination

    • Utilize native nanodiscs extracted from R. leguminosarum

These optimized approaches would contribute to resolving the complete conformational landscape of R. leguminosarum MscL, providing insights into how this channel responds to mechanical stimuli at the molecular level and potentially revealing unique features compared to previously characterized MscL homologs .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.