Recombinant Rhizobium leguminosarum bv. viciae Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to YidC in Rhizobium leguminosarum

YidC is a membrane-integrated insertase critical for the biogenesis of inner membrane proteins in bacteria. In Rhizobium leguminosarum bv. viciae, YidC (encoded by the yidC gene, locus tag RL0453) functions as part of the General Export Pathway (GEP), facilitating the insertion and folding of membrane proteins either independently or cooperatively with the Sec translocon . Unlike Escherichia coli YidC, which has been extensively characterized, Rhizobium YidC remains understudied, though genomic analyses confirm its homology and essential role in membrane protein biogenesis .

Gene Identification and Localization

The yidC gene in R. leguminosarum bv. viciae 3841 is chromosomally encoded and not part of an operon. Key features include:

PropertyDetail
Locus TagRL0453
Protein LengthPredicted ~60 kDa (exact length unconfirmed)
HomologyShares 45% sequence identity with E. coli YidC
Functional DomainsSix transmembrane helices; large periplasmic P1 domain

Recombinant Production

Recombinant Rhizobium YidC can be produced in E. coli expression systems, as demonstrated for homologs like Nitrosococcus oceani YidC . A hypothetical protocol would involve:

  1. Cloning: Amplification of yidC (RL0453) with a His-tag fusion.

  2. Expression: Induction in E. coli BL21(DE3) using IPTG.

  3. Purification: Ni-NTA affinity chromatography, yielding >90% purity .

Sec-Independent Insertase Activity

YidC operates independently of the Sec translocon for substrates such as phage coat proteins (e.g., Pf3) and small membrane proteins . Key findings from homologous systems:

  • Substrate Recognition: Hydrophobic transmembrane segments (TMS) interact with YidC’s hydrophilic groove and conserved residues (e.g., Arg72) .

  • Energy Efficiency: Catalyzes insertion without ATP hydrolysis, driven by lipid interactions and membrane potential .

Synergy with the Sec Translocon

For multi-pass membrane proteins (e.g., ATP synthase subunits), YidC collaborates with SecYEG to ensure proper folding and topology . Mutations in YidC’s hydrophobic slide (TM3/TM5) disrupt SecY interaction, impairing substrate insertion .

Comparative Analysis of YidC Homologs

OrganismRoleKey SubstratesUnique Features
E. coliSec-dependent/independent insertaseF0c, LacY, Pf3 coatWell-characterized structural motifs
R. leguminosarum bv. viciaeMembrane protein assembly in symbiosisUncharacterized (predicted: symbiosis-related proteins)RL0453 locus; GEP component
Nitrosococcus oceaniRecombinant modelOverexpressed in E. coli 545-aa length; His-tagged

Research Implications and Applications

  1. Agricultural Biotechnology: Rhizobium YidC may facilitate the insertion of symbiosis-specific membrane proteins critical for nitrogen fixation .

  2. Structural Biology: Molecular dynamics simulations (e.g., Pf3 coat insertion mechanisms) provide templates for studying Rhizobium YidC .

  3. Industrial Protein Production: Recombinant YidC systems could optimize membrane protein yields for biochemical studies .

Challenges and Future Directions

  • Substrate Specificity: Identification of native Rhizobium YidC substrates remains a priority.

  • Structural Resolution: Cryo-EM or crystallography of Rhizobium YidC could elucidate unique mechanistic features.

  • Functional Partners: Exploration of interactors (e.g., YibN-like proteins) to clarify regulatory roles .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yidC; RL0453; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-598
Protein Length
full length protein
Species
Rhizobium leguminosarum bv. viciae (strain 3841)
Target Names
yidC
Target Protein Sequence
MMENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKAQEAQKAQQQTEQVQQPAAGGQTP AQTSGAAPSGQAAATATLEQALQKSPRVVIDTPALSGSINLAGARLDDLKLKGYHETVDD SSPIITLFSPAETKDGYFTELGYIGSDATGSVPGPSTLWTAPEGAKLTEKTPVTLSYTND KGLTFTRTISVDERYMFTVADKIENTGQAPAALSSYGRVTRYNKPTTPSVYVLHEGFIGV IGDDGLIETKYSAVEKEAVAPAKSTGGWLGITDKYWAATIVPPQSAAYEAHFSYFADGQP RYQADYKDDAFTVAPGQSIELKNLVFAGAKEVPVIDGYEASYSIPKFDRLIDWGWFYFIT KPMFKLMDFFFRYFGNFGVAILCTTIVVKALFFPLASKQYASMANMKRMQPKMEELKAKF ADDRMGLQQATMQLYKEEKINPIAGCWPVALQIPIFFSLYKVIYITIEMRHAPFFGWIKD LSAPDPTTIVNLFGLLPFEGPTLLHLGVWPLIMGVTMFVQMRMNPTPPDPTQAMIFNWMP LVFMFMLASFPAGLVIYWAWNNTLSVAQQGLIMKRHGVKVELFDNLKGLFRRKEAPSK
Uniprot No.

Target Background

Function

This protein is essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It participates in the integration of membrane proteins dependent on and independent of the Sec translocase complex, as well as some lipoproteins. Furthermore, it aids in the folding of multispanning membrane proteins.

Database Links

KEGG: rle:RL0453

STRING: 216596.RL0453

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its primary function in Rhizobium leguminosarum bv. viciae?

YidC is an essential membrane protein insertase that plays a critical role in the integration of proteins into the cytoplasmic membrane. In Rhizobium leguminosarum bv. viciae, as in other bacteria, YidC functions as both an independent insertase and as a chaperone within the SecYEG complex mechanism . Its primary function involves facilitating the folding and insertion of membrane proteins, which is crucial for cellular viability . The protein contains a characteristic U-shaped hydrophilic groove that is closed on the periplasmic side but exposed to the cytoplasmic side of the membrane bilayer, creating a specialized environment for substrate proteins during the insertion process .

How does the structure of YidC contribute to its function as a membrane insertase?

The structural features of YidC are directly linked to its insertase function. Key structural elements include:

  • A U-shaped hydrophilic groove formed by transmembrane helices TM1-TM5

  • A water-filled cavity that creates a hydrophilic environment within the membrane

  • A cytoplasmic domain that recognizes substrate proteins

During membrane protein insertion, YidC's hydrophilic groove initially contains water molecules that provide a "water slide" motion for the entering protein. As the substrate protein progresses through the insertion process, the cytoplasmic groove becomes more compact, pushing water molecules out of the transmembrane groove . This dehydration creates a hydrophobic shift in the region, making it more favorable for membrane insertion. The hydrophilic cavity effectively reduces the energy barrier associated with insertion by shortening the hydrophobic core of the membrane .

What experimental models have been used to study YidC in Rhizobium leguminosarum?

Research on YidC in Rhizobium leguminosarum has employed several experimental approaches:

  • Genetic analysis: Studies have utilized 16S rRNA sequencing to identify and confirm Rhizobium strains

  • Fluorescence microscopy: GFP fusion proteins have been used to visualize the expression and localization of YidC

  • Molecular dynamics simulations: These have been employed to study the conformational dynamics of YidC during the insertion process

  • Single-molecule force spectroscopy: This technique has been used to monitor how YidC guides the folding of polytopic membrane proteins into membranes

It's important to note that some research initially intended for E. coli has inadvertently involved Rhizobium strains due to contamination issues, which has provided unexpected insights into YidC function across bacterial species .

How can researchers create and verify YidC knockout strains in Rhizobium leguminosarum?

Creating YidC knockout strains in Rhizobium leguminosarum requires careful methodological consideration since YidC is an essential gene. The following protocol is recommended based on lessons learned from previous research:

  • Complementation strategy: Before attempting to knock out genomic yidC, transform the bacterium with a plasmid expressing a functional copy of yidC (such as pEH1-yidC-GFP) .

  • Lambda-red recombination system: Use the lambda-red recombination system, typically encoded on a temperature-sensitive plasmid like pKD46, to facilitate the knockout process .

  • Verification steps:

    • PCR verification using primers that flank the targeted gene region

    • 16S rRNA sequencing to confirm strain identity (essential to avoid misidentification issues)

    • Fluorescence microscopy to verify GFP-tagged YidC expression

    • Growth tests at multiple temperatures (20°C, 30°C, and 37°C) to assess phenotype

  • Controls: Include proper wild-type controls and perform careful species verification to avoid contamination issues that have affected previous research .

Researchers should be aware that previous attempts to create yidC knockout strains have resulted in contamination with Rhizobium species being mistaken for E. coli, due to both being rod-shaped Gram-negative bacteria with similar morphology .

What molecular biology techniques are most effective for studying YidC-mediated protein insertion?

Several complementary techniques have proven effective for studying YidC-mediated protein insertion:

  • In vitro single-molecule force spectroscopy: This technique allows researchers to monitor the stepwise insertion and folding process of substrate proteins in real-time. Studies using this approach have revealed that YidC accelerates and chaperones the insertion and folding of polytopic membrane proteins like MelB .

  • Molecular dynamics simulations: These have been valuable for examining water content within the YidC groove during insertion, demonstrating the "water slide" mechanism and subsequent dehydration process .

  • In vivo complementation assays: Using conditionally depleted strains to test whether YidC can facilitate insertion in the absence of other components (like SecYEG) .

  • Fluorescence-based assays: GFP fusion proteins can be used to track the localization and expression levels of YidC and its substrate proteins .

  • Structural analysis: Techniques such as cryo-electron microscopy can provide insights into the conformational changes of YidC during the insertion process.

How can researchers differentiate between YidC-dependent and SecYEG-dependent membrane protein insertion?

Differentiating between YidC-dependent and SecYEG-dependent insertion pathways requires a systematic approach:

  • Conditional depletion experiments: Create strains where either YidC or SecYEG components can be conditionally depleted. For example, studies have shown that MelB can insert in the absence of SecYEG if YidC resides in the cytoplasmic membrane .

  • Substrate protein analysis: Certain characteristics of substrate proteins can indicate their likely insertion pathway:

    • Small phage coat proteins like Pf3 and M13 typically use a Sec-independent, YidC-dependent pathway

    • Larger, more complex proteins often require the SecYEG translocon with YidC acting as a chaperone

  • Direct comparison assays: Study the insertion efficiency of the same substrate protein in:

    • Wild-type cells

    • YidC-depleted cells

    • SecYEG-depleted cells

    • Cells depleted of both systems

  • Kinetic measurements: Compare the rate of insertion via different pathways using techniques like pulse-chase experiments or real-time fluorescence assays.

How does the function of YidC in Rhizobium leguminosarum compare to its homologs in other bacteria?

The function of YidC in Rhizobium leguminosarum shows both similarities and differences when compared to its homologs in other bacteria:

OrganismYidC CharacteristicsFunctional SpecificityReference
Rhizobium leguminosarumContains essential periplasmic domainsInvolved in symbiotic processes; facilitates insertion of proteins related to nitrogen fixation
E. coliWell-characterized with essential functionInvolved in incorporation of subunit II of cytochrome o oxidase; assists in the folding and insertion of membrane proteins
Other bacteriaConserved insertase functionSpecies-specific substrate preferences

What are the current challenges in studying YidC conformational dynamics during the membrane protein insertion process?

Studying YidC conformational dynamics presents several significant challenges:

  • Capturing transient intermediate states: The insertion process involves multiple intermediate conformational states that are difficult to capture experimentally.

  • Membrane environment complexity: Recreating the native membrane environment in experimental settings is challenging but crucial for understanding authentic YidC function.

  • Integration of data from different techniques: Combining insights from structural, biochemical, and computational approaches requires sophisticated integration methods.

  • Substrate-specific variations: YidC may adopt different conformational states depending on the specific substrate being inserted, requiring comprehensive studies across various substrate proteins.

  • Technical limitations: High-resolution structural techniques often require protein stabilization, which can alter the natural dynamics of the insertion process.

How does YidC contribute to the symbiotic process between Rhizobium leguminosarum bv. viciae and leguminous plants?

The role of YidC in the symbiotic relationship between Rhizobium leguminosarum bv. viciae and leguminous plants is complex and involves several aspects:

  • Membrane protein insertion for symbiosis: YidC likely facilitates the insertion of membrane proteins essential for establishing and maintaining symbiosis, including transporters and receptors involved in signaling between the bacterium and host plant .

  • Nitrogen fixation machinery: As Rhizobium leguminosarum bv. viciae is involved in biological nitrogen fixation, YidC may play a crucial role in inserting components of the nitrogen fixation machinery into the bacterial membrane .

  • Adaptation to host environment: The insertase activity of YidC helps the bacterium adapt to the changing environment within the host plant by facilitating the integration of necessary membrane proteins.

  • Secretion system components: Rhizobium leguminosarum bv. viciae contains protein secretion systems that are important for infection and establishing symbiosis. YidC may be involved in the assembly of these secretion systems .

Studies have identified secreted proteins in Rhizobium leguminosarum bv. viciae 3841 that influence infection and modify plant defense signaling pathways . While direct evidence linking YidC to the insertion of specific symbiosis-related proteins is still emerging, its essential role in membrane protein insertion suggests a significant contribution to the symbiotic process.

What are the most common issues encountered when working with recombinant YidC from Rhizobium leguminosarum, and how can they be addressed?

Researchers working with recombinant YidC from Rhizobium leguminosarum frequently encounter several technical challenges:

  • Expression and stability issues:

    • Problem: YidC is a membrane protein that can be difficult to express and maintain in a stable, functional form.

    • Solution: Optimize expression conditions by testing different expression systems (E. coli, yeast, insect cells), varying induction parameters, and including stabilizing agents in buffers.

  • Contamination and misidentification:

    • Problem: Misidentification of bacterial strains, as demonstrated by the case where Rhizobium was mistaken for E. coli .

    • Solution: Regularly verify strain identity through 16S rRNA sequencing and maintain rigorous laboratory practices to prevent cross-contamination .

  • Functional assessment challenges:

    • Problem: Determining whether recombinant YidC is functionally active.

    • Solution: Develop reliable functional assays, such as in vitro membrane insertion assays with known YidC substrates or complementation tests in YidC-depleted strains.

  • Purification difficulties:

    • Problem: Membrane proteins like YidC are notoriously difficult to purify while maintaining native structure.

    • Solution: Use mild detergents, amphipols, or nanodiscs to maintain YidC in a near-native lipid environment during purification and subsequent experiments.

  • Temperature sensitivity:

    • Problem: Some Rhizobium strains show temperature sensitivity, growing at 20°C and 30°C but not at 37°C .

    • Solution: Carefully control growth temperature and include temperature gradient experiments in your protocols.

How can researchers optimize experimental conditions to study YidC-mediated insertion of specific substrate proteins?

Optimizing experimental conditions for studying YidC-mediated protein insertion requires attention to several key factors:

  • Substrate selection:

    • Choose well-characterized substrate proteins such as Pf3 coat protein or MelB that have established insertion pathways .

    • Consider using chimeric proteins with reporter domains to facilitate detection and quantification.

  • Membrane environment optimization:

    • Test different lipid compositions to mimic the native membrane environment of Rhizobium leguminosarum.

    • Consider the influence of membrane potential and pH on insertion efficiency.

  • Detection method selection:

    • Fluorescence-based methods using GFP fusions allow real-time monitoring of insertion .

    • Protease protection assays can determine topology and insertion efficiency.

    • Single-molecule force spectroscopy provides detailed insights into the stepwise insertion process .

  • Control experiments:

    • Include parallel experiments with YidC-independent substrates as negative controls.

    • Use SecYEG-dependent substrates to differentiate between insertion pathways.

    • Perform experiments with mutated YidC variants to identify critical functional residues.

  • Data analysis strategies:

    • Implement quantitative analysis methods to measure insertion kinetics.

    • Use computational modeling to interpret experimental data in the context of structural information.

What quality control measures should be implemented when working with Rhizobium leguminosarum cultures in YidC research?

Establishing robust quality control measures is essential for reliable results in YidC research using Rhizobium leguminosarum:

  • Strain verification:

    • Regularly sequence the 16S rRNA gene to confirm strain identity .

    • Maintain proper documentation of strain histories and sources.

    • Create glycerol stocks of verified strains early in the research process.

  • Culture conditions standardization:

    • Maintain consistent growth media composition (e.g., YEMA containing 0.3% CaCO₃ for Rhizobium cultivation) .

    • Standardize inoculum size (typically 10⁸ cells ml⁻¹) and growth conditions .

    • Monitor growth rates and morphology to detect potential contamination.

  • Plasmid stability assessment:

    • Regularly check for plasmid retention under experimental conditions.

    • Maintain appropriate antibiotic selection pressure throughout experiments.

    • Verify the sequence of key genetic constructs periodically.

  • Protein expression verification:

    • Confirm YidC expression levels using Western blotting or fluorescence techniques.

    • Check for correct localization of YidC fusion proteins.

    • Assess the functionality of recombinant YidC through complementation assays.

  • Contamination prevention:

    • Implement strict aseptic techniques.

    • Use separate equipment and reagents for different bacterial species.

    • Include negative controls in PCR and other molecular biology procedures to detect contamination.

Special attention should be paid to temperature conditions during experiments, as Rhizobium species can have different optimal growth temperatures compared to commonly used laboratory strains like E. coli, which could influence experimental outcomes .

What are the most promising avenues for future research on YidC in Rhizobium leguminosarum?

Several promising research directions could significantly advance our understanding of YidC in Rhizobium leguminosarum:

  • Comprehensive substrate identification:

    • Systematic identification of the complete set of proteins that require YidC for membrane insertion in Rhizobium leguminosarum.

    • Comparative analysis with YidC substrates in other bacterial species to identify commonalities and differences.

  • Structure-function relationships:

    • High-resolution structural studies of Rhizobium leguminosarum YidC, particularly in complex with substrate proteins.

    • Investigation of how specific structural features contribute to insertase function and substrate specificity.

  • Role in symbiosis:

    • Exploration of how YidC contributes to the establishment and maintenance of symbiotic relationships with leguminous plants.

    • Investigation of YidC's role in inserting membrane proteins involved in nitrogen fixation processes .

  • Environmental adaptability:

    • Study of how YidC function adapts to different environmental conditions encountered by Rhizobium during free-living versus symbiotic states.

    • Analysis of YidC's role in membrane remodeling during environmental transitions.

  • Evolutionary analysis:

    • Comparative genomic and functional studies across different Rhizobium species and strains.

    • Investigation of how YidC has evolved specialized functions in different bacterial lineages.

How might advances in structural biology techniques enhance our understanding of YidC function in Rhizobium leguminosarum?

Emerging structural biology techniques hold significant potential for advancing YidC research:

  • Cryo-electron microscopy (cryo-EM):

    • Potential to capture YidC in different conformational states during the insertion process.

    • Ability to visualize YidC-substrate complexes without the need for crystallization.

  • Integrative structural biology approaches:

    • Combining multiple techniques (X-ray crystallography, NMR, cryo-EM, molecular dynamics) to build comprehensive structural models.

    • Correlation of structural data with functional assays to establish structure-function relationships.

  • Time-resolved structural methods:

    • Application of time-resolved cryo-EM or X-ray free-electron laser (XFEL) techniques to capture transient intermediates in the insertion process.

    • Potential to visualize the dynamic process of substrate insertion in near-atomic detail.

  • In situ structural biology:

    • Development of methods to study YidC structure and function directly in the native membrane environment.

    • Correlative light and electron microscopy to connect structural information with cellular localization and function.

  • Computational methods:

    • Enhanced molecular dynamics simulations incorporating experimentally derived constraints.

    • AI-based approaches for predicting YidC-substrate interactions and conformational changes.

These advanced structural approaches would provide unprecedented insights into the conformational dynamics of YidC during the membrane protein insertion process, particularly the water movements within the hydrophilic groove that appear critical for facilitating insertion .

What are the implications of understanding YidC function for broader research on bacterial membrane protein insertion mechanisms?

Research on YidC in Rhizobium leguminosarum has broader implications for understanding fundamental aspects of bacterial physiology and potential applications:

  • Comparative membrane biology:

    • Insights from Rhizobium YidC research contribute to our understanding of membrane protein insertion across diverse bacterial species.

    • Identification of conserved mechanisms and species-specific adaptations in membrane protein biogenesis.

  • Symbiotic relationship engineering:

    • Better understanding of YidC's role in symbiosis could lead to enhanced engineering of Rhizobium strains for improved nitrogen fixation capabilities.

    • Potential applications in sustainable agriculture through optimized plant-microbe interactions.

  • Antibiotic development:

    • As an essential protein for bacterial viability, YidC represents a potential target for novel antimicrobial compounds.

    • Structural and functional differences between YidC variants in different bacteria could be exploited for species-specific targeting.

  • Membrane protein production technologies:

    • Insights into YidC-mediated insertion mechanisms could improve technologies for the production of challenging membrane proteins for structural and functional studies.

    • Development of optimized expression systems incorporating YidC co-expression for difficult-to-express membrane proteins.

  • Fundamental cell biology:

    • YidC research contributes to our basic understanding of how cells build and maintain their membranes.

    • Insights into how bacteria adapt their membrane composition and protein content in response to environmental changes, particularly during host interactions.

Understanding the precise mechanisms by which YidC facilitates membrane protein insertion and folding, including the role of the hydrophilic groove and water dynamics , will advance our fundamental knowledge of membrane biology while potentially enabling biotechnological applications in areas ranging from agriculture to medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.