Recombinant Rhizobium leguminosarum bv. viciae Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for tailored fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
mtgA; RL4627; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Rhizobium leguminosarum bv. viciae (strain 3841)
Target Names
mtgA
Target Protein Sequence
MDIAPEREDSVDMPARRRWFEDRRVLKRIVLAVLIVLILPYALIVFYLLPFIHPVSTLML RDLVLLRGYDRQWVSLDNIAPVVVQSVMMSEDGQYCFHGGVDWAEMRMLVEDTLKGQATR GGSTIPMQTAKNLFLWNGRSFVRKALELPLAVTTDFVLSKRRLMEIYLNIAEWGPGIYGI EAAARHHFKVPASKLTRRQASLLAVSLPNPIDRNAGKPGRGLRRLAGVIERRAQGSGDYI KCIYD
Uniprot No.

Target Background

Function
A peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links

KEGG: rle:RL4627

STRING: 216596.RL4627

Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What evolutionary patterns are observed in peptidoglycan biosynthesis genes within Rhizobium species?

Peptidoglycan biosynthesis genes in Rhizobium show interesting evolutionary patterns influenced by homologous recombination. Research on closely related Rhizobium species has demonstrated that recombination significantly impacts the adaptive evolution of core genome components. Analysis of 3,086 core protein-coding sequences across 196 genomes from five Rhizobium species revealed that the proportion of amino acid substitutions fixed by adaptive evolution (α) varies from 0.07 to 0.39 across species and positively correlates with recombination levels .

This evolutionary pattern suggests that genes involved in cell wall biosynthesis, including transglycosylases like mtgA, likely experience selective pressures that are influenced by recombination rates. When designing experiments involving mtgA, researchers should consider these evolutionary dynamics, particularly when comparing orthologous genes across different Rhizobium strains or related species.

How does the structure-function relationship of monofunctional transglycosylases compare between Rhizobium and other bacterial species?

Monofunctional transglycosylases (MGTs) share conserved functional domains across bacterial species while displaying species-specific adaptations. In comparing Rhizobium mtgA with characterized MGTs from other bacteria, researchers should note that these enzymes typically range around 240-250 amino acids in length, with S. aureus MGT comprising 253 amino acids .

The catalytic function of these enzymes - polymerizing glycan strands during peptidoglycan biosynthesis - is conserved, but substrate specificity and regulatory mechanisms often differ. Experimental approaches to study mtgA function should include:

  • Sequence alignment of Rhizobium mtgA with characterized MGTs (like S. aureus)

  • Identification of conserved catalytic domains

  • Structural prediction using homology modeling

  • Functional assays using glycan polymerization activity measurements

When designing recombinant expression systems, researchers should consider that S. aureus mgt has multiple potential translational start sites, which could also be the case for Rhizobium mtgA .

What are the optimal cloning strategies for recombinant expression of mtgA from Rhizobium leguminosarum?

Based on successful approaches with similar enzymes, the following methodology is recommended:

  • Gene Amplification: Design PCR primers that incorporate appropriate restriction sites (NdeI at 5' end and BamHI at 3' end have worked well for similar enzymes) . Consider the following PCR conditions:

    • Initial denaturation: 94°C for 5 minutes

    • 25-30 cycles of: 94°C for 30 seconds, 55-60°C for 30 seconds, 72°C for 1 minute

    • Final extension: 72°C for 10 minutes

  • Vector Selection: pET-16b or similar expression vectors with T7 promoter systems are suitable for controlled expression .

  • Construct Verification: Always sequence the entire coding region to confirm:

    • Absence of mutations

    • Correct reading frame

    • Proper incorporation of tags if applicable

  • Special Considerations:

    • Evaluate multiple potential start codons if gene annotation is uncertain

    • Consider creating truncated versions if N-terminal regions contain predicted membrane-spanning domains

When designing your cloning strategy, carefully analyze the gene sequence for potential internal restriction sites that might interfere with your chosen cloning method .

What methodological approaches are recommended for measuring mtgA enzymatic activity?

For assessing the enzymatic activity of recombinant mtgA, a glycan polymerization assay is recommended, adapting protocols used for similar transglycosylases:

Materials:

  • Membrane fractions containing peptidoglycan precursors (can be prepared from Aerococcus viridans ATCC 10400 or similar sources)

  • Radiolabeled UDP-N-acetylglucosamine (specific activity ~4,000 cpm/nmol)

  • UDP-N-acetylmuramylpentapeptide

  • Buffer components: MgCl₂, KCl, NH₄Cl

  • Penicillin G (to inhibit transpeptidase activity)

Protocol:

  • Prepare reaction mixture (70 μl) containing:

    • Membrane fraction (50 μg protein)

    • 0.38 mM [¹⁴C]UDP-N-acetylglucosamine

    • 0.33 mM UDP-N-acetylmuramylpentapeptide

    • 50 mM MgCl₂

    • 0.21 mM KCl

    • 0.83 mM NH₄Cl

    • 250 μg/ml penicillin G

    • Buffer (50 mM Tris-HCl + 50 mM PIPES) at pH 6.1 or 8.0

  • Incubate reaction at optimal temperature (30°C for Rhizobium)

  • Monitor incorporation of radiolabeled precursors into TCA-precipitable material

  • Quantify activity as nmol of incorporated precursor per time unit per mg of enzyme

This assay should be optimized specifically for Rhizobium mtgA by testing different pH conditions and temperature optima.

How can researchers investigate the role of mtgA in Rhizobium-legume symbiotic interactions?

Investigating mtgA's role in symbiosis requires a multifaceted approach:

  • Gene Deletion/Complementation Studies:

    • Generate mtgA knockout mutants using CRISPR-Cas9 or homologous recombination

    • Create complementation strains expressing wild-type mtgA

    • Develop point mutants in catalytic domains

  • Symbiosis Assays:

    • Plant infection tests with wild-type, mutant, and complemented strains

    • Nodulation efficiency quantification

    • Nitrogen fixation measurements

    • Microscopic analysis of infection thread formation

  • Regulatory Context Analysis:

    • Investigate whether mtgA is regulated by iron-responsive regulators like RirA, which has been shown to be essential for mutualistic interactions of related Sinorhizobium fredii with legume hosts

    • Examine expression patterns during different stages of symbiosis

  • Data Collection and Analysis:

ParameterWild-typemtgA mutantComplemented strain
Nodules per plantn₁n₂n₃
Nodule weightw₁w₂w₃
Nitrogenase activitya₁a₂a₃
Infection thread formationi₁i₂i₃
Bacteroid differentiationd₁d₂d₃

Statistical analysis should include ANOVA with post-hoc tests to determine significant differences between strains across multiple host plants.

How should researchers approach contradictory data when studying recombinant mtgA function?

When faced with contradictory results in mtgA research, implement a systematic validation framework:

  • Identify Potential Sources of Contradiction:

    • Differences in experimental conditions

    • Variability in protein preparation

    • Host strain effects on recombinant expression

    • Assay sensitivity and specificity issues

  • Validation Strategy:

    • Use multiple independent methods to measure the same parameter

    • Implement internal controls for each experimental condition

    • Develop a hierarchical testing approach to isolate variables

  • Contradiction Resolution Framework:

    • Document all experimental conditions meticulously

    • Systematically vary one parameter at a time

    • Use statistical methods designed for detecting experimental inconsistencies

    • Consider applying contradiction detection methodologies similar to those used in data validation systems

  • Cross-Validation Table Example:

ParameterMethod 1Method 2Method 3Consistency Assessment
Enzyme activityValue ± SDValue ± SDValue ± SDConsistent/Inconsistent
Substrate specificityResultResultResultConsistent/Inconsistent
pH optimumRangeRangeRangeConsistent/Inconsistent
Temperature stabilityValue ± SDValue ± SDValue ± SDConsistent/Inconsistent

This systematic approach helps distinguish between true biological variability and methodological inconsistencies when studying recombinant mtgA .

What bioinformatic approaches are recommended for studying the evolution of mtgA in Rhizobium species?

To investigate mtgA evolution across Rhizobium species, implement the following bioinformatic workflow:

  • Sequence Collection and Alignment:

    • Gather mtgA sequences from multiple Rhizobium species and related bacteria

    • Perform multiple sequence alignment using MUSCLE or MAFFT

    • Trim alignments to remove poorly aligned regions

  • Recombination Analysis:

    • Calculate intragenic linkage disequilibrium to estimate recombination rates

    • Divide genes into recombination classes based on LD metrics (similar to approaches used in other Rhizobium studies)

    • Use methods like RDP4 or GARD to detect recombination breakpoints

  • Adaptive Evolution Assessment:

    • Calculate the ratio of non-synonymous to synonymous substitutions (dN/dS)

    • Estimate the proportion of adaptive amino acid changes (α) using site frequency spectrum and divergence data

    • Apply McDonald-Kreitman test to identify signatures of selection

  • Visualization and Interpretation:

SpeciesRecombination Rateα EstimatedN/dS RatioAdaptive Evolution Rate (ωa)
R. leguminosarum bv. viciaeValueValueValueValue
R. leguminosarum bv. trifoliiValueValueValueValue
R. etliValueValueValueValue
R. tropiciValueValueValueValue
S. melilotiValueValueValueValue

How does the genetic context of mtgA compare between Rhizobium species, and what methodology should be used to investigate this?

To analyze the genomic context and organization of mtgA across Rhizobium species:

  • Genomic Context Mapping:

    • Extract 10-20 kb regions flanking mtgA from multiple Rhizobium genomes

    • Identify conserved gene neighborhoods and synteny patterns

    • Map orthologous genes using bidirectional best hits approach

  • Regulatory Element Identification:

    • Search for conserved promoter motifs upstream of mtgA

    • Identify potential transcription factor binding sites

    • Investigate if mtgA is part of an operon structure

  • Comparative Analysis Methodology:

    • Use tools like Mauve or ACT for visualization of genomic context

    • Apply phylogenetic profiling to identify co-evolving genes

    • Search for horizontally transferred genomic islands containing mtgA

  • Contextual Data Interpretation Framework:

SpeciesOperon StructureUpstream GenesDownstream GenesPotential Regulators
Species 1DescriptionGene listGene listFactor list
Species 2DescriptionGene listGene listFactor list
Species 3DescriptionGene listGene listFactor list

How can researchers effectively analyze and compare mtgA enzymatic activity data across different experimental conditions?

To ensure robust comparison of mtgA activity data:

  • Standardization Protocol:

    • Define a standard unit of mtgA activity

    • Include internal controls in each experiment

    • Normalize activities to protein concentration verified by multiple methods

  • Statistical Analysis Framework:

    • Use appropriate statistical tests based on data distribution

    • Apply mixed-effects models for experiments with multiple variables

    • Calculate effect sizes in addition to p-values

  • Meta-Analysis Approach:

    • Develop a systematic data collection template

    • Document all experimental parameters that might affect activity

    • Use forest plots to visualize variations across conditions

  • Activity Comparison Matrix:

Experimental ConditionActivity (Units/mg)Relative Activity (%)Statistical Significance
Standard conditionValue ± SD100%Reference
Condition 1Value ± SD%p-value
Condition 2Value ± SD%p-value
Condition 3Value ± SD%p-value

This structured approach helps identify genuine biological effects versus methodological variations, particularly important when analyzing potentially contradictory data . When publishing results, researchers should provide sufficient methodological details to enable reproduction by other laboratories.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.