Recombinant Rhizobium leguminosarum bv. viciae NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics of nuoK

nuoK is a 102-amino-acid subunit (UniProt ID: Q1MIK4) of the NDH-1 complex, which catalyzes electron transfer from NADH to quinone while translocating protons across the membrane . Key features include:

  • Gene Name: nuoK (Ordered Locus Name: RL1711) .

  • Enzyme Classification: EC 1.6.99.5 (NADH-quinone oxidoreductase) .

PropertyDetail
Molecular WeightNot explicitly provided in sources; estimated via sequence analysis.
Prosthetic GroupsNone reported; part of a multi-subunit complex requiring quinone.
FunctionElectron transfer in NDH-1; proton translocation (inferred from homologs) .

Production and Purification

The recombinant nuoK is typically expressed in E. coli and purified via affinity chromatography due to an N-terminal His tag :

  • Expression System: E. coli (e.g., strain BL21(DE3)) .

  • Purification: Nickel or cobalt-based affinity columns for His-tagged proteins .

  • Purity: >90% as determined by SDS-PAGE .

Comparative Analysis:

OrganismSubunitKnown Roles
Rhizobium leguminosarumnuoKPart of NDH-1; role in symbiotic energy metabolism?
Vibrio choleraeNqrFNa⁺-translocating NQR; proton-pumping activity .
Paracoccus denitrificansNQO6Quinone-binding site; critical for electron transfer .

Challenges and Future Directions

  • Functional Elucidation: The specific role of nuoK in R. leguminosarum symbiosis (e.g., bacteroid differentiation) remains unexplored .

  • Symbiotic Interactions: Potential cross-talk between bacterial (nuoK) and plant amyloid proteins (e.g., pea vicilin) in nodules warrants investigation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for the specific delivery time.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage condition, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
nuoK; RL1711; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Rhizobium leguminosarum bv. viciae (strain 3841)
Target Names
nuoK
Target Protein Sequence
MVIGLSHYLTVSAILFTLGVFGIFLNRKNVIVILMSIELILLAVNINMVAFSSFLNDIVG QVFALFILTVAAAEAAIGLAILVVFYRNRGSIAVEDVNMMKG
Uniprot No.

Target Background

Function
NDH-1 functions as an electron shuttle, transferring electrons from NADH to quinones in the respiratory chain. This process is facilitated by FMN and iron-sulfur (Fe-S) centers. In this specific organism, ubiquinone is thought to be the immediate electron acceptor for the enzyme. NDH-1 couples the redox reaction with proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy in a proton gradient.
Database Links

KEGG: rle:RL1711

STRING: 216596.RL1711

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of NADH-quinone oxidoreductase in Rhizobium leguminosarum bv. viciae energy metabolism?

NADH-quinone oxidoreductase (Complex I) serves as the primary entry point for electrons into the respiratory chain of Rhizobium leguminosarum bv. viciae. This multi-subunit enzyme complex couples the oxidation of NADH to NAD+ with the reduction of quinones, while simultaneously translocating protons across the membrane to generate a proton motive force essential for ATP synthesis.

During symbiotic nitrogen fixation, bacteroid metabolism shifts significantly toward the use of dicarboxylates as carbon sources, with induction of dicarboxylate transport, gluconeogenesis, and alanine synthesis pathways, while sugar utilization is repressed . The decarboxylating arm of the tricarboxylic acid cycle is highly induced, generating reducing equivalents like NADH . Complex I then oxidizes this NADH to support the high energy demands of nitrogen fixation, making it a crucial component of bacteroid energy metabolism.

Experimental studies have demonstrated that bacteroids isolated from nodules at different developmental stages (7, 15, and 21 days post-inoculation) show distinct metabolic profiles, suggesting temporal regulation of respiratory components including NADH-quinone oxidoreductase .

How is the nuoK gene organized within the genome of Rhizobium leguminosarum bv. viciae?

The nuoK gene in Rhizobium leguminosarum bv. viciae is part of the nuo operon, which encodes the 14 subunits (NuoA-N) of the NADH-quinone oxidoreductase complex. Genomic analysis of Rhizobium leguminosarum bv. viciae reveals a complex genome organization consisting of a chromosome and several plasmids .

The nuo genes are typically located on the chromosome rather than on symbiotic plasmids, as they encode core metabolic functions. This chromosomal location is consistent with the conserved nature of respiratory complexes across bacterial species. In contrast, genes specifically involved in symbiosis, such as nod, nif, and fix genes, are often located on symbiotic plasmids .

Comparative genomic studies between different genospecies of Rhizobium leguminosarum show high conservation of core metabolic genes including those involved in respiration, whereas significant variation is observed in the content and organization of symbiotic genes . This genomic architecture reflects the evolutionary pressures on maintaining essential metabolic functions while allowing for diversification of host-specific symbiotic capabilities.

What are the structural characteristics and membrane topology of the nuoK subunit?

The nuoK subunit of NADH-quinone oxidoreductase is a small, hydrophobic membrane protein typically containing three transmembrane α-helices. These helices anchor the protein within the membrane arm of the complex, where they contribute to the formation of the proton translocation pathway.

Key structural characteristics of nuoK include:

  • Molecular weight: Approximately 10-12 kDa

  • Membrane topology: Three transmembrane helices spanning the bacterial inner membrane

  • Conserved residues: Several charged amino acids (glutamate, lysine) believed to participate in proton transfer

  • Protein-protein interactions: Forms close associations with other membrane subunits (nuoJ, nuoL, nuoM)

The functional importance of nuoK lies in its contribution to proton pumping rather than in direct electron transfer. The protein's structure creates a hydrophilic channel within the hydrophobic membrane environment, allowing for controlled proton movement across the membrane.

To experimentally study the structure of recombinant nuoK, spectroscopic methods examining the range of 300-800 nm can be employed to identify potential cofactors, similar to approaches used for other oxidoreductases .

How does the expression of nuoK change during bacteroid development in legume nodules?

Gene expression analysis reveals significant metabolic reprogramming during bacteroid development in Rhizobium leguminosarum bv. viciae. Transcriptomic studies conducted at 7, 15, and 21 days post-inoculation demonstrate distinct temporal patterns in the expression of genes involved in energy metabolism .

While specific data on nuoK expression is not directly provided in the available research, the established patterns for respiratory genes suggest that:

  • Early nodule development (7 days): Initial adaptation to the microaerobic environment is characterized by large changes in the expression of regulators, exported and cell surface molecules, multidrug exporters, and stress response proteins . Respiratory genes likely undergo regulation during this phase to adapt to oxygen limitation.

  • Mid-stage development (15 days): As nitrogen fixation becomes established, energy demands increase, potentially leading to upregulation of respiratory components including nuoK.

  • Mature nodules (21 days): fix genes continue to increase in expression in mature bacteroids, while nif genes show strong induction . The sustained energy requirements during this phase suggest continued high expression of respiratory complex components.

The decarboxylating arm of the tricarboxylic acid cycle is particularly induced in early (7-day) nodules, generating NADH that would require processing by NADH-quinone oxidoreductase . This suggests that nuoK expression might be coordinately regulated with other components of central carbon metabolism during bacteroid development.

What experimental strategies are optimal for expressing and purifying functional recombinant nuoK protein?

Expressing and purifying membrane proteins like nuoK presents significant challenges due to their hydrophobic nature. A comprehensive strategy includes:

Expression system selection:

  • Homologous expression in Rhizobium: Maintains native membrane environment and processing machinery

  • Heterologous expression in E. coli: BL21(DE3) strain with pET vectors for high-yield production

  • Cell-free systems: For difficult cases where in vivo toxicity limits expression

Optimization parameters:

  • Temperature: Lower temperatures (16-22°C) typically improve membrane protein folding

  • Induction conditions: Low inducer concentrations (0.1-0.5 mM IPTG) for slower expression

  • Media supplements: Addition of glycerol (5-10%) to stabilize membranes

  • Fusion tags: N-terminal tags (His6, MBP) to aid purification while avoiding interference with membrane insertion

Purification protocol:

  • Membrane isolation: Gentle cell lysis followed by differential centrifugation

  • Detergent screening: Systematic testing of detergents (DDM, LMNG, CHAPS) for solubilization

  • Chromatography sequence: Affinity chromatography → Ion exchange → Size exclusion

  • Quality assessment: SDS-PAGE, western blotting, and spectroscopic analysis (300-800 nm) for cofactor identification

Functional validation:

  • Reconstitution into liposomes or nanodiscs to recreate membrane environment

  • Activity assays measuring NADH oxidation (monitoring absorbance at 340 nm)

  • Proton translocation assays using pH-sensitive dyes

  • pH optimum determination using appropriate buffer systems (e.g., 50 mM MOPS)

The success of recombinant nuoK expression should be evaluated not only by protein yield but also by proper folding and functional integration into the membrane environment.

How do mutations in the nuoK gene affect bacteroid development and nitrogen fixation efficiency?

Investigating the phenotypic consequences of nuoK mutations requires a systematic approach:

Mutation strategies:

  • Site-directed mutagenesis: Targeting conserved residues predicted to be involved in proton translocation

  • Deletion mutagenesis: Complete removal of nuoK to assess essentiality

  • Random mutagenesis: Mini-Tn5 transposon mutagenesis as employed in previous studies of Rhizobium

Phenotypic analysis framework:

Expected outcomes:
Mutations in nuoK might not completely abolish nitrogen fixation but could significantly reduce its efficiency due to compromised energy generation. Previous studies screening mini-Tn5 mutants revealed genes essential for nitrogen fixation, including those encoding a potential magnesium transporter, an AAA domain protein, and proteins involved in cytochrome synthesis . Similarly, nuoK mutations might reveal the specific contribution of NADH-quinone oxidoreductase to bacteroid energy metabolism.

Complementation studies:
To confirm phenotype specificity, complementation with wild-type nuoK and various mutant alleles can distinguish between direct effects of nuoK mutation and polar effects on other nuo genes.

What metabolic adaptations occur in NADH-quinone oxidoreductase during the transition from free-living to symbiotic lifestyles?

The transition from free-living to symbiotic lifestyle in Rhizobium leguminosarum bv. viciae involves profound metabolic reprogramming, particularly in energy generation pathways:

Carbon substrate utilization:
Bacteroid metabolism shifts dramatically from sugar utilization in free-living cells to dicarboxylate metabolism in bacteroids . Microarray experiments comparing bacteria grown on various carbon substrates (glucose, pyruvate, succinate, inositol, acetate, and acetoacetate) to bacteroids revealed that bacteroid metabolism most closely resembles that of dicarboxylate-grown cells .

Respiratory adaptations:

  • Oxygen limitation: The microaerobic environment in nodules necessitates adaptations in respiratory chain components

  • Energy efficiency: High ATP demands for nitrogen fixation require efficient energy conservation

  • Redox balance: Maintenance of appropriate NAD+/NADH ratios becomes critical

Temporal regulation:
Gene expression analysis at 7, 15, and 21 days post-inoculation demonstrates distinct phases of metabolic adaptation :

  • Early adaptation (7 days): Initial response to the nodule environment

  • Establishment phase (15 days): Development of nitrogen fixation machinery

  • Mature function (21 days): Sustained energy production to support nitrogen fixation

Molecular evidence:
The decarboxylating arm of the tricarboxylic acid cycle is highly induced in bacteroids, particularly in early (7-day) nodules . This increased TCA cycle activity generates NADH that must be efficiently processed by NADH-quinone oxidoreductase, suggesting potential upregulation or structural adaptation of the complex, including the nuoK subunit.

How does the nuoK subunit contribute to the proton translocation mechanism of NADH-quinone oxidoreductase?

The nuoK subunit plays a specific role in the proton translocation mechanism of NADH-quinone oxidoreductase:

Structural contribution:
As one of the membrane-embedded subunits, nuoK forms part of the proton translocation pathway. Its transmembrane helices contain conserved charged residues that participate in creating a hydrophilic channel through the hydrophobic membrane core.

Proton pumping mechanism:

  • Conformational coupling: Electron transfer in the peripheral arm induces conformational changes transmitted to the membrane domain

  • Proton relay system: Charged and polar residues in nuoK form part of a relay system for controlled proton movement

  • Channel formation: nuoK contributes to the formation of discrete proton channels connecting the bacterial cytoplasm to the periplasm

Research approaches:

  • Site-directed mutagenesis of conserved residues to identify those essential for proton translocation

  • Measurement of proton/electron (H+/e-) stoichiometry in wild-type versus nuoK mutants

  • Determination of proton translocation efficiency using pH-sensitive dyes or electrodes

  • Structural analysis through cryo-electron microscopy to visualize nuoK's position within the complex

Understanding nuoK's contribution to proton translocation is particularly relevant in the context of bacteroid energy metabolism, where efficient energy conservation is crucial for supporting nitrogen fixation.

What are the optimal protocols for measuring NADH-quinone oxidoreductase activity in Rhizobium leguminosarum bacteroids?

Measuring NADH-quinone oxidoreductase activity in bacteroids requires specialized techniques that account for the unique properties of these symbiotic cells:

Bacteroid isolation protocol:

  • Nodule collection: Harvest nodules at defined time points (7, 15, 21 days post-inoculation)

  • Gentle homogenization: Crush nodules in isotonic buffer to release bacteroids

  • Differential centrifugation: Separate bacteroids from plant material

  • Purification: Percoll gradient centrifugation to obtain clean bacteroid preparations

Activity assay methods:

  • Spectrophotometric assays:

    • NADH oxidation: Monitor decrease in absorbance at 340 nm

    • Ubiquinone reduction: Track changes at wavelengths specific to the quinone

    • Artificial electron acceptors: Use of ferricyanide or DCPIP as alternative electron acceptors

  • Polarographic methods:

    • Oxygen consumption: Clark-type oxygen electrode measurements

    • Inhibitor sensitivity: Response to rotenone, piericidin A, or other Complex I inhibitors

  • Membrane potential measurements:

    • Fluorescent dyes: Potential-sensitive probes like DiSC3(5)

    • Ion-selective electrodes: Direct measurement of proton translocation

Standardized assay conditions:

  • Buffer: 50 mM MOPS (pH 7.4) based on optimal conditions for oxidoreductases

  • Temperature: 25-30°C, maintaining physiological relevance

  • Substrate concentrations: 100-200 μM NADH and appropriate quinone concentrations

  • Controls: Heat-inactivated bacteroids and specific inhibitors

Data analysis:

  • Initial rate calculations using linear regression of the early reaction phase

  • Normalization to protein content or bacteroid number

  • Comparative analysis between developmental stages (7, 15, 21 days)

  • Statistical evaluation of biological and technical replicates

This methodological framework enables quantitative assessment of NADH-quinone oxidoreductase activity throughout bacteroid development.

What molecular biology techniques are most effective for cloning and expressing the nuoK gene?

Effective cloning and expression of the nuoK gene requires specialized techniques for handling membrane protein genes:

Gene amplification strategy:

  • Primer design:

    • Forward primer: Include restriction site, ribosome binding site, and N-terminal tag if needed

    • Reverse primer: Incorporate restriction site and stop codon

    • Example: 5'-CATATGCACCACCACCACCACCACATG[nuoK-specific sequence]-3' (forward)

    • Example: 5'-CTCGAGTTA[nuoK-specific sequence]-3' (reverse)

  • PCR optimization:

    • High-fidelity polymerase (Q5, Phusion) to minimize mutations

    • Gradient PCR to determine optimal annealing temperature

    • Addition of DMSO or betaine for GC-rich templates

Vector selection considerations:

  • Expression vectors:

    • pET series (T7 promoter): High-level controlled expression

    • pBAD series (arabinose promoter): Tunable expression levels

    • pRK-based vectors: For expression in Rhizobium

  • Fusion partners:

    • N-terminal tags: His6, MBP, or SUMO to enhance solubility

    • C-terminal tags: Only if C-terminus is not critical for membrane insertion

Transformation and selection:

  • E. coli cloning hosts: DH5α for plasmid propagation

  • Expression hosts: BL21(DE3), C41(DE3), or C43(DE3) for membrane proteins

  • Rhizobium transformation: Electroporation or triparental mating

Expression verification:

  • Colony PCR to confirm insert presence

  • Restriction digestion to verify insert size

  • Sanger sequencing to confirm sequence accuracy

  • Western blotting to detect expressed protein

  • Membrane fraction analysis to confirm proper localization

This comprehensive approach addresses the challenges specific to cloning and expressing membrane proteins like nuoK, maximizing the chances of obtaining functional recombinant protein.

How can researchers design and implement mutagenesis studies to identify critical residues in nuoK?

A systematic mutagenesis approach is essential for identifying functionally important residues in nuoK:

Target residue selection:

  • Sequence conservation analysis: Multiple sequence alignment of nuoK homologs to identify conserved residues

  • Structural prediction: Homology modeling to identify residues in putative proton channels

  • Charge distribution analysis: Focus on charged residues (Asp, Glu, Lys, Arg) within transmembrane domains

  • Literature-based selection: Residues implicated in proton translocation in related organisms

Mutagenesis strategies:

  • Alanine-scanning mutagenesis:

    • Systematic replacement of selected residues with alanine

    • Removes side chain functionality while maintaining α-helical structure

    • Example: Conversion of charged residues (Glu → Ala) to disrupt proton relay

  • Conservative substitutions:

    • Replacement maintaining similar properties (e.g., Glu → Asp)

    • Tests importance of side chain length or precise positioning

  • Charge reversal:

    • Conversion of acidic to basic residues or vice versa (Glu → Lys)

    • Examines role of charge in proton translocation

Phenotypic characterization:

  • In vitro assays:

    • NADH oxidation activity of purified enzyme

    • Proton translocation efficiency

    • H+/e- stoichiometry determination

  • In vivo assessments:

    • Growth under various conditions

    • Nodulation capacity and efficiency

    • Nitrogen fixation rates (acetylene reduction)

Structure-function correlation:
Create a functional map correlating mutagenesis results with structural models to generate a comprehensive understanding of nuoK's role in proton translocation.

This approach parallels successful strategies used in previous studies of Rhizobium, where screening of mini-Tn5 mutants revealed previously uncharacterized genes essential for nitrogen fixation .

How should researchers analyze transcriptomic data to interpret nuoK expression patterns during symbiosis?

Rigorous analysis of transcriptomic data is essential for understanding nuoK expression patterns during symbiosis:

Data processing workflow:

  • Quality control: Filtering of low-quality reads and normalization procedures

  • Mapping: Alignment to the Rhizobium leguminosarum bv. viciae reference genome

  • Expression quantification: Calculation of RPKM/FPKM/TPM values for nuoK

  • Differential expression analysis: Statistical comparison between conditions

Contextual analysis framework:

  • Co-expression patterns:

    • Correlation with other nuo operon genes to identify co-regulation

    • Comparison with TCA cycle genes that show high induction in bacteroids

    • Relationship to fix and nif genes that show specific temporal patterns

  • Temporal profiling:

    • Expression at defined time points (7, 15, 21 days post-inoculation)

    • Correlation with developmental stages of bacteroids

    • Identification of expression peaks corresponding to energy demands

  • Statistical validation:

    • Application of appropriate statistical tests (t-test, ANOVA)

    • Multiple testing correction for genome-wide analyses

    • Determination of significance thresholds

Visualization and interpretation:
The following table represents a framework for interpreting nuoK expression in context:

Developmental StageDays Post-InoculationExpected nuoK Expression PatternBiological InterpretationRelated Metabolic Changes
Early development7 daysModerate increaseAdaptation to microaerobic environmentHigh induction of TCA cycle decarboxylating arm
Mid-stage15 daysSignificant increaseEstablishment of energy generationContinuing increase in fix gene expression
Mature nodule21 daysSustained high levelsSupporting active nitrogen fixationStrong induction of nif genes

Validation approaches:

  • RT-qPCR confirmation of key expression changes

  • Protein-level verification using antibodies or tagged constructs

  • Correlation of expression with enzymatic activity measurements

This analytical approach places nuoK expression in the broader context of bacteroid development and metabolism, enabling meaningful biological interpretation of transcriptomic data.

What bioinformatic approaches can identify conserved functional domains in nuoK across different Rhizobium species?

Comprehensive bioinformatic analysis can reveal conserved functional domains in nuoK:

Sequence-based approaches:

  • Multiple sequence alignment:

    • Collection of nuoK sequences from diverse Rhizobium species

    • Progressive alignment algorithms (MUSCLE, CLUSTALW, MAFFT)

    • Visualization tools (Jalview, ESPript) to identify conserved residues

  • Conservation scoring:

    • Calculation of position-specific conservation scores

    • Identification of invariant residues across species

    • Application of conservation metrics (Shannon entropy, BLOSUM62 scores)

  • Motif identification:

    • Search for known transmembrane motifs

    • De novo motif discovery in aligned sequences

    • Correlation with known functional sites in related proteins

Structure-based methods:

  • Transmembrane topology prediction:

    • TMHMM, HMMTOP for helical topology

    • Identification of membrane-spanning regions

    • Localization of charged residues within transmembrane segments

  • Homology modeling:

    • Template identification from structural databases

    • Model building using Modeller, SWISS-MODEL, or I-TASSER

    • Refinement and validation of structural models

  • Molecular dynamics simulations:

    • In silico assessment of structural stability

    • Identification of potential proton pathways

    • Prediction of residue interactions during conformational changes

Evolutionary analysis:

  • Phylogenetic tree construction:

    • Maximum likelihood or Bayesian methods

    • Correlation with Rhizobium speciation patterns

    • Identification of potential horizontal gene transfer events

  • Selection pressure analysis:

    • Calculation of dN/dS ratios to identify sites under selection

    • Detection of episodic or pervasive selection

    • Correlation of selective pressure with functional importance

This multi-faceted bioinformatic approach integrates sequence, structure, and evolutionary information to identify functionally critical domains in nuoK, providing targets for subsequent experimental validation.

How might advances in structural biology techniques contribute to understanding nuoK function in the NADH-quinone oxidoreductase complex?

Emerging structural biology techniques offer exciting opportunities for elucidating nuoK function:

Cryo-electron microscopy (cryo-EM):

  • High-resolution structure determination of intact NADH-quinone oxidoreductase

  • Visualization of nuoK within the membrane domain context

  • Identification of protein-protein interactions with neighboring subunits

  • Potential capture of different conformational states during the catalytic cycle

Integrative structural biology approaches:

  • Combination of X-ray crystallography, NMR, and cryo-EM data

  • Cross-linking mass spectrometry to identify interacting residues

  • Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

  • Small-angle X-ray scattering for solution-state structural information

Time-resolved structural methods:

  • Time-resolved cryo-EM to capture transient states

  • Serial femtosecond crystallography using X-ray free electron lasers

  • Electron paramagnetic resonance spectroscopy to track electron transfer events

  • Infrared spectroscopy to monitor protonation state changes

In silico structure-function analysis:

  • Molecular dynamics simulations of proton movement through nuoK

  • Quantum mechanics/molecular mechanics calculations of electron transfer

  • Coarse-grained modeling of conformational coupling between peripheral and membrane arms

  • Prediction of mutational effects on complex stability and function

These advanced structural approaches, when combined with functional studies, will provide unprecedented insights into how nuoK contributes to the proton translocation mechanism of NADH-quinone oxidoreductase in Rhizobium leguminosarum bv. viciae.

What research gaps remain in understanding the relationship between nuoK function and nitrogen fixation efficiency?

Despite significant advances in understanding bacteroid metabolism, several critical research gaps remain regarding nuoK function and nitrogen fixation:

Mechanistic understanding gaps:

  • Precise contribution of nuoK to proton translocation efficiency

  • Relationship between respiratory chain adaptation and nitrogenase activity

  • Role of nuoK in maintaining optimal redox balance in bacteroids

  • Potential interactions between nuoK and other symbiosis-specific proteins

Methodological challenges:

  • Difficulty in isolating intact NADH-quinone oxidoreductase from bacteroids

  • Limited tools for studying membrane protein dynamics in vivo

  • Challenges in measuring proton translocation in intact bacteroids

  • Need for non-invasive methods to monitor bacterial energetics in nodules

Translational research opportunities:

  • Engineering nuoK variants with enhanced proton pumping efficiency

  • Targeting respiratory chain optimization for improved nitrogen fixation

  • Development of bacteroid bioenergetic status as a predictor of symbiotic efficiency

  • Correlation of nuoK polymorphisms with host-specific adaptation

Integrative research needs:

  • Systems biology approaches linking transcriptomics, proteomics, and metabolomics data

  • Multi-omics studies of energy metabolism across bacteroid development stages

  • Comparative studies across different Rhizobium-legume symbioses

  • Field-relevant assessments of laboratory findings

Addressing these research gaps requires interdisciplinary approaches combining molecular genetics, biochemistry, structural biology, and systems biology. The insights gained will contribute to our fundamental understanding of the energetics of nitrogen fixation and potentially inform strategies for improving symbiotic efficiency in agricultural contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.