Recombinant Rhizobium leguminosarum bv. viciae Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Role

UppP (EC 3.6.1.27) performs the reaction:

undecaprenyl diphosphate+H2Oundecaprenyl phosphate+phosphate\text{undecaprenyl diphosphate} + \text{H}_2\text{O} \rightleftharpoons \text{undecaprenyl phosphate} + \text{phosphate}

This activity is enhanced by divalent cations like Ca²⁺ . In Rhizobium leguminosarum, UppP contributes to:

  • Peptidoglycan biosynthesis: Recycling undecaprenyl phosphate for cell wall assembly .

  • Bacitracin resistance: Bacitracin binds undecaprenyl diphosphate, and UppP activity counteracts this inhibition .

Applications in Research

  • Antibiotic Resistance Studies: UppP’s role in bacitracin resistance makes it a target for antimicrobial strategies .

  • Enzyme Kinetics: Used to study divalent cation dependence and substrate specificity .

  • Symbiotic Function: R. leguminosarum UppP may influence nodulation efficiency in legumes by modulating cell envelope integrity .

Key Research Findings

  1. Plasmid Rearrangement: In R. leguminosarum bv. viciae VF39, symbiotic plasmid (pSym) rearrangements alter uppP localization, affecting bacterial adaptability .

  2. Transcriptional Regulation: Deletion of plasmid pRleVF39b in R. leguminosarum increases uppP expression by 4-fold, suggesting plasmid-mediated repression .

  3. EPS Biosynthesis Link: UppP activity indirectly affects exopolysaccharide (EPS) production via UDP-glucose pool modulation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; RL0328; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Rhizobium leguminosarum bv. viciae (strain 3841)
Target Names
uppP
Target Protein Sequence
MDYINAAILGVIEGITEFLPISSTGHLIIAEQWLGHRSDMFNIVIQAGAILAVTIIYWRR LVDLVLGWRDPVNRDYAAKLIVAFLITAILGLVVKKLGFELPETATPIAWALIIGGIWMI FAEWAAARRPPHKEITWLVAILVGIAQIVAGVFPGTSRSGATIFVAMLAGTGNRASATEF AFLVGIPTMYAASAYELLKTFRDGGAAGEDWTALGIAFVVSTVVAFIAVKWLLAYIRSNR FTLFAIYRIILGVLLLGMAATGLIA
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: rle:RL0328

STRING: 216596.RL0328

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.