Recombinant Rhizobium leguminosarum bv. viciae UPF0283 membrane protein RL2646 (RL2646)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes if needed. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion in the manufacturing process.
Synonyms
RL2646; UPF0283 membrane protein RL2646
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Rhizobium leguminosarum bv. viciae (strain 3841)
Target Names
RL2646
Target Protein Sequence
MSKPPSDPPRRAPAAFIYEDEATERRDNGRQGGERRKPESFSEHIVVTPDEDDPFLNPDK DLSAVPVAAPRKRRTSFGKIAAGAFGILLSLAIGLWTDSLIRDLFTRADWLGYAALAVLA VGILAVLALVIRETSGMMRLATVQTIKAEADAAMLETRPVKARAVVARLTALLSANPETA KGRATLKATEGEVIDPPHLMALAERELLAPLDRKARALIVNASKRVSIVTAVSPRAVVDL LYVLYEAVRLIRAMAELYGSRPGTLGMFRLLRDVLAHLAVTGSIAVGDSLVQQVLGHGLA SKLSARLGEGVINGLMTARIGIAAMDLCRPLAFRALKRPGIGDFIGDLTPSMSPRGNNP
Uniprot No.

Target Background

Database Links

KEGG: rle:RL2646

STRING: 216596.RL2646

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rhizobium leguminosarum bv. viciae and what role does the UPF0283 membrane protein RL2646 play?

Rhizobium leguminosarum biovar viciae is a nitrogen-fixing bacterium that forms symbiotic relationships with leguminous plants. The UPF0283 membrane protein RL2646 is a 359-amino acid protein encoded by the RL2646 gene . While classified as an uncharacterized protein family (UPF0283), membrane proteins in Rhizobium species often play critical roles in establishing and maintaining symbiotic relationships with host plants. Research approaches to study this protein typically include comparative genomics, structural analysis, and functional characterization through gene knockout or overexpression studies to determine its role in symbiotic nitrogen fixation processes.

How does RL2646 compare to other membrane proteins in the Rhizobium genus?

The RL2646 membrane protein belongs to the UPF0283 family and shares structural features common to membrane proteins, including multiple transmembrane domains. Comparative analysis should begin with sequence alignment using tools like BLAST or Clustal Omega to identify homologs in other Rhizobium species. Subsequently, phylogenetic analysis can reveal evolutionary relationships, while structural prediction tools can identify conserved domains. Research indicates that while Rhizobium species maintain genetic isolation across their core genomes, they may share functional membrane proteins through horizontal gene transfer mechanisms, particularly on symbiotic plasmids that show high recombination rates . When analyzing comparative data, researchers should present findings in properly formatted tables rather than lists, ensuring clear organization of sequence identity percentages, evolutionary distances, and functional predictions.

What experimental design is most appropriate for studying RL2646 function in Rhizobium-legume symbiosis?

When investigating RL2646 function in symbiotic relationships, a completely randomized design (CRD) is appropriate for controlled laboratory experiments, while randomized block design (RBD) or Latin square design (LSD) is recommended for field or greenhouse studies that need to account for environmental variables . For laboratory investigations, experimental units should be homogeneous bacterial cultures subjected to different treatments (e.g., gene knockout, overexpression, site-directed mutagenesis) . Field studies examining plant-bacteria interactions should account for block effects such as soil heterogeneity or light gradients.

A comprehensive experimental design should include:

  • Clear definition of treatments (e.g., wild-type vs. RL2646 mutant strains)

  • Appropriate replication (minimum 3-6 biological replicates)

  • Controls for both bacterial and plant components

  • Measurements of multiple symbiotic parameters (nodulation efficiency, nitrogen fixation rates, plant growth)

  • Statistical power analysis to determine sample size requirements

Data collection should follow standardized protocols with proper table formatting that includes clear column headers, units of measurement, and consistent significant figures .

How should researchers design experiments to assess the impact of environmental factors on RL2646 expression and function?

For investigating environmental impacts on RL2646 expression and function, a factorial experimental design is most appropriate as it allows simultaneous evaluation of multiple factors and their interactions . Key environmental factors to consider include:

  • Temperature ranges (typically 15-30°C for Rhizobium)

  • pH gradients (5.0-8.0)

  • Soil/media composition (nutrient availability, particularly fixed nitrogen)

  • Water potential/drought stress

  • Host plant genotype

The design should incorporate randomized block design principles to account for spatial or temporal variations in experimental conditions . Data collection must include both protein expression levels (via quantitative proteomics or western blotting) and functional assays (membrane integrity, symbiotic performance). Researchers should ensure that experimental units are properly randomized to treatment combinations, with balanced replication across all factor levels. Statistical analysis should employ ANOVA for identifying main effects and interactions, followed by appropriate post-hoc tests for specific comparisons .

What are the most effective protocols for isolating and purifying recombinant RL2646 protein for structural and functional studies?

The purification of recombinant RL2646 membrane protein requires specialized approaches due to its membrane-embedded nature. An effective isolation protocol involves:

  • Expression system selection: E. coli BL21(DE3) or similar strains with membrane protein expression capabilities

  • Vector design: Inclusion of affinity tags (His6 or FLAG) at either N- or C-terminus, ensuring the tag doesn't interfere with membrane topology

  • Cell disruption: Gentle lysis using enzymatic methods or pressure-based systems

  • Membrane fraction isolation: Ultracentrifugation (100,000×g) to separate membranes

  • Solubilization: Detergent screening (DDM, LDAO, or CHAPS) at concentrations just above CMC

  • Affinity chromatography: Using tag-specific resins under optimized detergent conditions

  • Size exclusion chromatography: Final purification step to ensure homogeneity

The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C to maintain stability as indicated for commercial preparations . Purity assessment should employ SDS-PAGE and western blotting, while functional integrity can be verified through circular dichroism or limited proteolysis assays.

What analytical approaches should be used to investigate RL2646 interactions with other bacterial or plant proteins?

To comprehensively investigate RL2646 protein interactions, researchers should employ complementary approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against RL2646 or epitope tags to pull down interaction partners

  • Bacterial two-hybrid systems: Modified for membrane protein analysis using split-ubiquitin or BACTH systems

  • Proximity labeling: BioID or APEX2 fusion proteins to identify proximal interaction partners in native environments

  • Surface plasmon resonance (SPR): For quantitative binding kinetics of purified components

  • Crosslinking mass spectrometry: To capture transient or weak interactions followed by MS identification

  • Fluorescence microscopy: Localization studies using fluorescent protein fusions to track co-localization patterns

Data analysis should include appropriate controls for non-specific binding and statistical validation of identified interactions. Network analysis tools can help visualize the interaction landscape and identify central nodes in the interaction network. When comparing different experimental conditions, results should be presented in well-formatted tables with clear statistical parameters rather than simple lists .

How can researchers effectively analyze the genomic context of RL2646 across different Rhizobium strains?

Analyzing the genomic context of RL2646 across Rhizobium strains requires a systematic comparative genomics approach. Researchers should:

  • Obtain genome sequences: Access complete genome sequences of multiple Rhizobium strains, including chromosomes and all plasmids

  • Identify orthologs: Use bidirectional best hit (BBH) analysis or OrthoMCL to identify true orthologs

  • Synteny analysis: Examine conservation of gene order surrounding RL2646 using tools like SyMAP or MCScanX

  • Mobile genetic element detection: Identify if RL2646 is located on symbiotic plasmids or chromosomal regions

  • Evolutionary analysis: Calculate selection pressures (dN/dS ratios) to determine evolutionary constraints

Research indicates that while Rhizobium species maintain genetic isolation across their core genomes, symbiotic plasmids show high rates of recombination . This suggests that genes located on symbiotic plasmids may have different evolutionary histories than chromosomal genes. Therefore, researchers should analyze whether RL2646 shows patterns consistent with vertical inheritance or horizontal gene transfer. The analysis should include examination of GC content, codon usage patterns, and phylogenetic congruence with core genome trees.

What transcriptomic strategies are most informative for understanding RL2646 regulation during symbiosis establishment?

For comprehensive transcriptomic analysis of RL2646 regulation during symbiosis establishment, researchers should implement a time-course RNA-Seq experimental design capturing key developmental stages:

  • Pre-infection: Free-living bacteria and uninoculated plant roots (baseline)

  • Early interaction: 24-48 hours post-inoculation (recognition phase)

  • Nodule initiation: 3-5 days post-inoculation (infection thread formation)

  • Nodule development: 7-14 days post-inoculation (bacteroid differentiation)

  • Mature symbiosis: 21+ days post-inoculation (active nitrogen fixation)

For each timepoint, isolate RNA from both bacterial and plant partners, ensuring bacterial RNA enrichment from nodule samples using techniques like host rRNA depletion. The experimental design should include biological triplicates and appropriate controls (e.g., non-symbiotic mutants).

Data analysis should employ:

  • Differential expression analysis (DESeq2 or EdgeR)

  • Co-expression network analysis to identify genes with similar expression patterns

  • Promoter motif identification for co-regulated genes

  • Integration with ChIP-seq or DNA affinity purification sequencing (DAP-seq) data to identify transcription factors

These approaches can reveal regulatory networks controlling RL2646 expression during symbiosis, particularly in the context of population genomics studies showing that symbiotic plasmids can be shared among different Rhizobium species in the same agricultural plot .

How can researchers address contradictory data regarding RL2646 function in different experimental systems?

When facing contradictory results regarding RL2646 function across different experimental systems, researchers should implement a systematic troubleshooting approach:

  • Methodological audit: Compare experimental protocols in detail, including bacterial strains, growth conditions, and analytical techniques

  • Strain verification: Confirm the genetic identity of all strains using multilocus sequence typing or whole-genome sequencing

  • Variable identification: Design factorial experiments to identify environmental or host factors that might explain discrepancies

  • Meta-analysis approach: Quantitatively combine results from multiple studies to detect patterns

  • Multi-laboratory validation: Establish a standardized protocol and perform identical experiments across different laboratories

Genetic context is particularly important in Rhizobium research, as studies have shown that symbiotic plasmids can be shared between different species through horizontal gene transfer . This genetic exchange could lead to different functional outcomes depending on the genomic background. Researchers should determine if RL2646 is located on the chromosome or plasmids and assess if its function is influenced by other genetic elements specific to particular strains.

When analyzing contradictory data, create comprehensive comparison tables with standardized metrics across studies, clearly indicating experimental variables and outcomes with appropriate statistical analysis .

What are the most significant challenges in translating in vitro findings about RL2646 to field applications in agricultural settings?

Translating laboratory findings about RL2646 to agricultural applications presents several significant challenges:

  • Genetic stability: In agricultural settings, horizontal gene transfer between Rhizobium species is common, particularly for genes located on symbiotic plasmids . Modified strains may lose engineered features or transfer them to wild populations.

  • Environmental variability: Laboratory conditions poorly represent the complex soil environment with fluctuating temperatures, moisture levels, pH, and competing microorganisms.

  • Host genotype interactions: Plant genotype significantly influences symbiotic outcomes, requiring testing across diverse cultivars relevant to target agricultural regions.

  • Competition with indigenous rhizobia: Introduced strains must compete with established soil populations that may be less efficient but better adapted to local conditions.

  • Experimental design scaling: Field trials require appropriate design methodologies that account for soil heterogeneity, using randomized block designs or Latin square designs rather than completely randomized designs used in laboratory settings .

To address these challenges, researchers should implement a phased approach:

  • Controlled environment studies (growth chambers)

  • Greenhouse trials with agricultural soils

  • Small-scale field plots with intensive monitoring

  • Multi-site field trials across different environments

Each phase should employ appropriate experimental designs with sufficient replication and controls. Data collection should follow standardized protocols, and results should be presented in clear tables with relevant agronomic parameters .

What are the common pitfalls in RL2646 expression studies and how can researchers overcome them?

Researchers studying RL2646 expression commonly encounter several technical challenges that can compromise results:

  • Membrane protein insolubility: RL2646, as a membrane protein, often forms inclusion bodies during recombinant expression

    • Solution: Optimize expression conditions (lower temperature, reduced inducer concentration), use specialized strains (C41/C43), and explore fusion partners (MBP, SUMO)

  • RNA degradation during extraction: Bacterial RNA is particularly vulnerable to RNase contamination

    • Solution: Use immediate RNA stabilization reagents, maintain strict RNase-free conditions, and optimize extraction protocols specifically for Rhizobium

  • Cross-reactivity in antibody-based detection: Non-specific binding can lead to false positive results

    • Solution: Validate antibodies using knockout controls, perform peptide competition assays, and use orthogonal detection methods

  • Inconsistent normalization: Improper reference gene selection affects quantitative analysis

    • Solution: Validate multiple reference genes under experimental conditions using tools like geNorm or NormFinder

  • Poor experimental design: Inadequate replication or controls leads to uninterpretable results

    • Solution: Implement rigorous experimental design principles with appropriate randomization, blocking, and statistical power analysis

Researchers should document all optimization steps and include detailed methodological descriptions in publications to facilitate reproducibility. When presenting data, use properly formatted tables with clear headers, units, and consistent significant figures .

How should researchers approach data analysis and visualization for RL2646 localization studies?

For effective analysis and visualization of RL2646 localization data:

  • Image acquisition standardization:

    • Use consistent microscope settings (exposure, gain, laser power)

    • Include appropriate controls in each imaging session

    • Capture sufficient Z-stacks for 3D reconstruction

  • Quantitative analysis approach:

    • Implement automated segmentation of cellular compartments

    • Quantify protein distribution using colocalization coefficients (Pearson's, Mander's)

    • Analyze intensity profiles across defined cellular regions

  • Statistical rigor:

    • Analyze sufficient cells (typically >30 per condition)

    • Use appropriate statistical tests for comparing distributions

    • Account for multiple comparisons when necessary

  • Visualization best practices:

    • Present representative images alongside quantification

    • Include scale bars and consistent color mapping

    • Use split channels alongside merged images

  • Data presentation:

    • Create clear tables summarizing colocalization metrics across conditions

    • Use consistent formatting and include statistical significance indicators

    • Provide both raw data and processed results for transparency

When comparing localization under different conditions (e.g., symbiotic vs. free-living), use experimental designs that account for potential confounding factors . This might include randomized block designs if experiments are conducted over multiple days or with different bacterial cultures.

What emerging technologies offer new insights into RL2646 function and regulation?

Several cutting-edge technologies are poised to advance our understanding of RL2646:

  • Cryo-electron microscopy: Enabling high-resolution structural analysis of membrane proteins in near-native environments without crystallization

    • Application: Determine RL2646 structure in membrane context, potentially revealing functional domains

  • Single-cell transcriptomics: Capturing gene expression heterogeneity within bacterial populations

    • Application: Identify subpopulations with differential RL2646 expression during symbiosis stages

  • CRISPR interference/activation systems for Rhizobium: Enabling precise gene regulation without permanent genetic modification

    • Application: Modulate RL2646 expression temporally to determine stage-specific functions

  • Advanced bioinformatics for horizontal gene transfer detection: Tools to identify genes with signatures of recent transfer

    • Application: Determine if RL2646 shows evidence of horizontal transmission between Rhizobium species, as has been observed with symbiotic plasmids

  • In situ proteomics: Spatial protein analysis in intact nodules

    • Application: Track RL2646 localization during bacteroid differentiation

  • Long-read sequencing: Complete genomic context analysis

    • Application: Characterize large plasmids and repetitive regions surrounding RL2646

Implementation requires careful experimental design with appropriate controls and replication levels. Researchers should consider factorial designs when testing multiple conditions and use appropriate blocking factors when environmental variation is expected .

How might systems biology approaches enhance our understanding of RL2646 in the broader context of Rhizobium-legume symbiosis?

Systems biology approaches offer powerful frameworks for integrating multiple data types to understand RL2646 function:

  • Multi-omics integration: Combining transcriptomics, proteomics, metabolomics, and phenomics data

    • Methodology: Use multivariate statistical methods and correlation networks to identify relationships between RL2646 expression and metabolic shifts during symbiosis

    • Design considerations: Ensure synchronized sampling across platforms and include appropriate controls for each omics layer

  • Genome-scale metabolic modeling: Computational prediction of metabolic capabilities

    • Methodology: Develop constraint-based models incorporating RL2646 function to simulate symbiotic metabolism

    • Application: Predict metabolic consequences of RL2646 mutations or expression changes

  • Network analysis of protein-protein interactions: Mapping RL2646 into interaction networks

    • Methodology: Combine experimental interaction data with computational predictions to build comprehensive networks

    • Visualization: Present interaction networks with statistical confidence measures for each predicted interaction

  • Ecological modeling: Extending from molecular to ecosystem scales

    • Methodology: Model how variations in RL2646 function might affect plant growth, soil nutrient cycles, and agricultural productivity

    • Design considerations: Incorporate field-scale experimental designs like Latin square design to account for spatial heterogeneity

These approaches can help place RL2646 in the broader context of symbiotic nitrogen fixation, potentially revealing unexpected connections to other cellular processes. When presenting systems-level data, researchers should use well-formatted tables with clear column headers and appropriate statistical measures , while ensuring that the complexity of the data is adequately represented through proper visualization techniques.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.