Recombinant Rhizobium loti ATP synthase subunit a (atpB) is a transmembrane protein critical for ATP synthesis in the nitrogen-fixing bacterium Rhizobium loti (strain MAFF303099). This subunit forms part of the F0 sector of the ATP synthase complex, which couples proton translocation across membranes to ATP production . Produced via recombinant DNA technology in E. coli, it enables biochemical and structural studies of bacterial energy metabolism .
Amino Acid Sequence: Comprises 252 residues (UniProt ID: Q986D4), with a conserved sequence critical for proton channel formation :
MAADKVDPIHQFHIIKLVPINIGGYDLSFTNSALFMVATVVVAAAFLFLTTSSRSLVPGRLQSISEMAYEFVANMLRDAAGTQGMKFFPLVFSLFMFVLVANLLGLFPYFFTVTSHIIVTFGLAILVIGTVIVYGFMKHGLGFLKLFVPKGVPLVMMVLVVPIEVISFVSRPISLSVRLFANMLAGHITLKVFSGFVVSLSALGAVGVAGSILPLAMAVALTALELLVAFLQAYVFAVLTCMYLNDALHPSH
Proton Channel: Facilitates proton translocation via transmembrane helices .
Subunit Interaction: Binds to the F1 sector (α3β3γδε subunits) to enable rotational catalysis .
Proton Gradient Coupling: Used to study Na+/H+ translocation in hybrid F1F0 ATP synthases .
Rotational Catalysis: Serves as a model for single-molecule motor studies (e.g., γ-subunit rotation observed in F1-ATPase) .
Symbiotic Nitrogen Fixation: Investigated for its role in bacterial energetics during legume nodulation .
KEGG: mlo:mlr7411
STRING: 266835.mlr7411
ATP synthase subunit a (atpB) in Rhizobium loti is an integral component of the membrane-embedded FO sector of the ATP synthase complex. The protein functions primarily in proton translocation across the membrane, which is essential for the rotary mechanism that drives ATP synthesis. Structurally, the atpB gene in Rhizobium loti (strain MAFF303099) encodes a full-length protein of 252 amino acids, with the complete sequence available in databases under UniProt accession number Q986D4 . The protein contains multiple transmembrane domains that form proton channels through the membrane. Within the ATP synthase complex, subunit a interacts directly with the c-ring, creating the pathway for protons to flow through the membrane domain, which ultimately powers the conformational changes in the F1 catalytic domain that synthesize ATP .
These two subunits serve distinctly different functions within the ATP synthase complex:
| Feature | Subunit a (atpB) | Subunit beta (atpD) |
|---|---|---|
| Location | FO sector (membrane-embedded) | F1 sector (water-soluble) |
| UniProt ID | Q986D4 | Q98EV8 |
| Length | 252 amino acids | 477 amino acids |
| Function | Proton channel formation | Catalytic ATP synthesis |
| Structure | Multiple transmembrane domains | Globular structure with nucleotide binding sites |
| Genomic position in MAFF303099 | Not specified in sources | Position 3246882 |
While subunit a (atpB) is part of the membrane-integrated FO complex that forms the proton channel, subunit beta (atpD) is part of the F1 catalytic complex that synthesizes ATP from ADP and phosphate . The beta subunit contains the catalytic sites where ATP synthesis actually occurs, whereas subunit a facilitates the proton movement that powers this synthesis .
For optimal preservation of recombinant Rhizobium loti atpB protein activity, store the protein at -20°C for regular storage or at -80°C for extended storage periods. The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for stability . Repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and activity loss. For working solutions that will be used within one week, store aliquots at 4°C to minimize freeze-thaw damage . When reconstituting lyophilized protein preparations, it's advisable to briefly centrifuge the vial prior to opening to bring contents to the bottom. Use deionized sterile water for reconstitution to achieve a concentration between 0.1-1.0 mg/mL, and consider adding glycerol to a final concentration of 5-50% for improved stability during long-term storage .
The most commonly utilized expression system for producing recombinant Rhizobium loti ATP synthase subunit a (atpB) is Escherichia coli. This bacterial expression system allows for high-yield production of the target protein while maintaining proper folding and activity . The expression typically involves cloning the atpB gene from Rhizobium loti (strain MAFF303099) into a suitable expression vector containing an inducible promoter system. For optimal expression, codon optimization might be necessary due to potential codon usage differences between Rhizobium loti and E. coli. The resulting recombinant protein may include affinity tags to facilitate purification, though the specific tag type is often determined during the production process based on the protein's characteristics and intended applications . After expression, the protein undergoes purification steps typically involving affinity chromatography, followed by quality control assessments including SDS-PAGE to confirm purity and molecular weight.
Recombinant Rhizobium loti atpB can serve as a powerful molecular marker for phylogenetic studies of rhizobia, complementing the traditional 16S rRNA-based classification approaches. When conducting such studies, researchers should use a multi-gene approach by combining atpB sequence data with other conserved genes like atpD and recA to obtain a more robust phylogenetic tree that better reflects genome-wide evolutionary relationships . The methodology involves PCR amplification of the atpB gene using conserved primers, followed by sequencing and multiple sequence alignment with homologous genes from other rhizobial species. For phylogenetic tree construction, researchers should employ multiple algorithms (e.g., maximum likelihood, Bayesian inference, neighbor-joining) to test the robustness of the resulting topology. The atpB gene is particularly valuable because it's relatively conserved yet contains sufficient sequence variation to resolve relationships among closely related rhizobial species. Additionally, since atpB is chromosomally located and well-spaced from other phylogenetic markers like recA (which starts at position 24004 in M. loti strain MAFF303099), it provides independent evolutionary evidence that is less susceptible to horizontal gene transfer events that might distort phylogenetic signals .
Multiple complementary approaches can be employed to elucidate the interactions between atpB and other ATP synthase subunits:
Cross-linking studies: Use chemical cross-linkers with various spacer lengths to identify proximity relationships between atpB and neighboring subunits, particularly with the c-ring. The cross-linked products can be analyzed using mass spectrometry to identify interaction sites .
Site-directed mutagenesis: Systematically mutate conserved residues in atpB, especially those in transmembrane regions, to identify amino acids critical for proton translocation and interaction with the c-ring. Functional assays measuring ATP synthesis rates or proton pumping can then assess the impact of these mutations .
Co-immunoprecipitation studies: Develop antibodies against recombinant Rhizobium loti atpB to pull down the entire ATP synthase complex, followed by Western blotting to identify associated subunits. This approach can be particularly useful for identifying transient or weak interactions that might be missed by other methods.
Cryo-electron microscopy: This technique can provide structural insights into the assembled ATP synthase complex at near-atomic resolution, revealing the precise orientation and interaction surfaces between atpB and other subunits, particularly within the membrane-embedded FO sector .
Förster resonance energy transfer (FRET): Engineer fluorescent protein fusions to atpB and potential interaction partners to measure energy transfer as an indicator of proximity in the native membrane environment.
Studying proton translocation through the atpB subunit presents several methodological challenges that require sophisticated approaches:
The primary challenge lies in reconstituting purified recombinant atpB into artificial membrane systems that maintain native-like functionality. This requires careful selection of lipid compositions that mimic the bacterial membrane environment of Rhizobium loti . Researchers must ensure proper orientation of the reconstituted protein, typically achieved using techniques like freeze-thaw cycles or detergent dialysis. Proton translocation measurements often employ pH-sensitive fluorescent dyes (such as ACMA or pyranine) encapsulated in proteoliposomes, but signal-to-noise ratios can be problematic due to background leakage. Additionally, distinguishing specific atpB-mediated proton translocation from non-specific leakage requires appropriate controls using specific inhibitors or mutated versions of the protein with altered proton pathways .
For more quantitative measurements, patch-clamp electrophysiology on reconstituted membranes can directly measure proton currents, though this technique demands substantial expertise. The challenge of maintaining the structural integrity of atpB during purification and reconstitution is particularly significant, as detergent solubilization can disrupt the native structure of this highly hydrophobic membrane protein with multiple transmembrane domains .
Structural predictions of Rhizobium loti atpB can systematically guide mutagenesis studies to uncover structure-function relationships. Begin by generating a high-confidence structural model using homology modeling based on crystal structures of ATP synthase subunit a from related organisms, or through ab initio modeling approaches enhanced with deep learning algorithms like AlphaFold2. These models can identify conserved domains, particularly the transmembrane regions and potential proton translocation pathways . Analyze the predicted structure for conserved residues in proton channels, which typically include charged amino acids (Arg, Glu, Asp) essential for proton translocation.
Once key residues are identified, design a targeted mutagenesis strategy that includes: (1) charge-reversal mutations to test electrostatic interactions, (2) conservative substitutions to assess the importance of specific chemical properties, and (3) cysteine scanning mutagenesis for subsequent accessibility studies. The mutagenesis should focus on residues within the predicted transmembrane domains and at interfaces with other subunits, particularly where the atpB is expected to interact with the c-ring . After generating the mutants, employ functional assays that measure ATP synthesis rates, proton pumping efficiency, or growth complementation in ATP synthase-deficient strains to assess the impact of each mutation. This structure-guided approach significantly increases the likelihood of identifying functionally important residues compared to random mutagenesis strategies.
Implementing comprehensive quality control measures when working with recombinant Rhizobium loti atpB is essential for ensuring experimental reproducibility. Begin with verifying protein identity through peptide mass fingerprinting or N-terminal sequencing, comparing results to the expected sequence (MAADKVDPIHQFHIIKLVPINIGGYDLSFTNSALFMVATVVVAAAFLFLTTSSRSLVPGR and subsequent amino acids) . Assess protein purity using SDS-PAGE with Coomassie staining, aiming for >85% purity as typically achieved with related ATP synthase subunits . For functional validation, consider reconstituting the protein into liposomes and measuring proton translocation using pH-sensitive fluorescent dyes. Additionally, circular dichroism spectroscopy can confirm proper secondary structure, which is particularly important for this membrane protein with multiple transmembrane domains.
Protein aggregation should be evaluated using dynamic light scattering or size exclusion chromatography, as membrane proteins like atpB are prone to aggregation. For applications requiring higher sensitivity, western blotting using antibodies specific to Rhizobium loti atpB or to attached affinity tags can provide additional confirmation of identity and integrity . Always perform these quality control measures on freshly thawed aliquots, as repeated freeze-thaw cycles can significantly impact protein quality.
When encountering difficulties with expression and purification of Rhizobium loti atpB, researchers should implement a systematic troubleshooting approach:
For poor expression yields, consider optimizing codon usage for the expression host, as membrane proteins often contain rare codons that can limit translation efficiency. Expression conditions should be carefully optimized - lower temperatures (16-20°C) often improve proper folding of membrane proteins like atpB . The choice of expression vector and promoter strength is critical; inducible systems with tunable expression levels may prevent toxic accumulation of the membrane protein. For purification challenges, test multiple detergents for solubilization, starting with milder options like n-dodecyl-β-D-maltoside (DDM) or digitonin that better preserve native structure. Consider adding stabilizing agents like glycerol (up to 50%) to buffers to prevent protein aggregation during purification .
If protein degradation occurs, include protease inhibitor cocktails in all buffers and consider using protease-deficient host strains. For proteins showing poor solubility, fusion partners like MBP (maltose-binding protein) can improve solubility, though they may need subsequent removal. When encountering difficulties with affinity purification, optimize binding conditions including buffer composition, pH, and salt concentration. Additionally, on-column refolding protocols may help recover properly folded protein from inclusion bodies if conventional approaches fail.
For functional assays measuring proton translocation or ATP synthesis, ensure identical protein-to-lipid ratios and experimental conditions (pH, temperature, ionic strength). Statistical robustness requires multiple biological replicates (minimum n=3) with appropriate controls including non-functional mutants. When interpreting results, researchers should correlate functional differences with specific sequence variations, potentially using site-directed mutagenesis to confirm the importance of identified residues. Additionally, phylogenetic analysis incorporating atpB alongside other genes like atpD and recA can provide evolutionary context for observed functional differences .
Recombinant Rhizobium loti atpB serves as a valuable tool for understanding the energetics underlying symbiotic nitrogen fixation. The ATP synthase complex plays a critical role in generating the ATP required for the energy-intensive nitrogen fixation process in root nodules. By studying atpB function in Rhizobium loti, researchers can gain insights into how energy metabolism is regulated during symbiosis establishment and maintenance . Comparative studies between free-living and symbiotic states can reveal potential regulatory mechanisms of ATP synthase activity in response to microaerobic nodule conditions. Using recombinant atpB in combination with site-directed mutagenesis, researchers can identify specific residues that might be involved in adaptation to the unique energetic demands of nitrogen fixation.
The genomic context of atpB can also provide insights into its regulation in relation to other symbiosis-related genes. In Mesorhizobium loti strain MAFF303099, the genomic positioning of atpB relative to other genes involved in energy metabolism or symbiosis-related functions may suggest coordinated regulation . Furthermore, studying the evolution of atpB across different rhizobial species that nodulate diverse legume hosts can reveal potential adaptations of energy metabolism to specific symbiotic relationships. This evolutionary perspective, combined with functional studies of the recombinant protein, can significantly advance our understanding of the energetic basis of this agriculturally and ecologically important symbiotic relationship.
Comparative analysis of atpB structure and function between rhizobia and pathogenic bacteria offers significant insights with potential applications in both agriculture and medicine. ATP synthase components including atpB are increasingly recognized as potential antimicrobial targets due to their essential role in bacterial energy metabolism . By identifying structural and functional differences between atpB in beneficial rhizobia versus pathogenic bacteria, researchers can potentially develop selective inhibitors that target pathogen ATP synthases while sparing beneficial soil microbes. This approach could lead to novel antimicrobials with reduced ecological impact.
The comparison may also reveal evolutionary adaptations in energy metabolism associated with different lifestyles. Rhizobia like Mesorhizobium loti must adapt to both free-living soil conditions and the microaerobic environment of root nodules, potentially requiring specific regulatory mechanisms for ATP synthase function . In contrast, pathogens often face different energetic challenges including host defense mechanisms and variable nutrient availability. Structural differences in atpB that correspond to these lifestyle adaptations could provide insights into bacterial adaptation mechanisms. Additionally, understanding conserved versus variable regions across diverse bacteria can inform structural biology approaches, potentially revealing unexplored druggable sites in the ATP synthase complex that could be targeted for antimicrobial development .
Structural studies of Rhizobium loti atpB can provide critical insights for designing selective ATP synthase inhibitors for agricultural applications. By determining the three-dimensional structure of this protein through techniques like X-ray crystallography or cryo-electron microscopy, researchers can identify unique structural features that distinguish rhizobial ATP synthases from those of plant pathogens . These distinctive structural elements can serve as selective targets for inhibitor design, potentially enabling the development of antimicrobials that specifically target plant pathogens while preserving beneficial rhizobia in agricultural soils.
The proton channel formed by atpB contains specific residues that are essential for proton translocation, and these residues may differ between beneficial and pathogenic bacteria . Comparative structural analysis can identify these differences, which can then be exploited using structure-based drug design approaches including virtual screening and molecular docking to identify compounds that selectively bind to pathogen-specific features. In vitro validation of candidate inhibitors would include testing against purified ATP synthases from both target pathogens and non-target beneficial bacteria like Rhizobium loti to confirm selectivity. Additionally, by understanding the structural basis of ATP synthase function in Rhizobium loti, researchers may identify novel regulatory mechanisms that could be exploited to enhance symbiotic efficiency, potentially leading to bioinoculants with improved nitrogen fixation capabilities for sustainable agriculture.
Several cutting-edge technologies are poised to significantly advance our understanding of Rhizobium loti atpB structure and function:
Cryo-electron microscopy has revolutionized membrane protein structural biology and can potentially resolve the structure of Rhizobium loti ATP synthase at near-atomic resolution, revealing precise interactions between atpB and other subunits in the context of the complete complex . This would provide unprecedented insights into the proton translocation mechanism. Complementing this approach, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map protein dynamics and conformational changes in response to different conditions, potentially revealing how atpB changes conformation during the catalytic cycle.
Single-molecule FRET techniques allow researchers to observe conformational changes in real-time at the individual molecule level, which could illuminate the dynamic relationship between proton translocation through atpB and rotary motion of the ATP synthase. For functional studies, the development of more sensitive proton flux assays using advanced fluorescent indicators can improve the detection of subtle functional differences in mutant variants. Additionally, microfluidic devices coupled with fluorescence detection systems could enable high-throughput screening of atpB variants or potential inhibitors.
In the computational realm, molecular dynamics simulations incorporating enhanced sampling methods can model proton movement through the atpB channel with increasing accuracy . These simulations, especially when informed by experimental structural data, could reveal the detailed mechanism of proton translocation. Finally, CRISPR-Cas genome editing in Rhizobium loti allows precise modification of atpB in its native context, enabling correlation of in vitro findings with in vivo physiological roles during both free-living growth and symbiotic nitrogen fixation.